Top 100 alternative sites to antislipsokken-vitaness.nl
Anti-Slip Floor Treatments, Slip Resistant Glow Tapes, Tactiles & Cleaning Products - The Anti-Slip Company
The Anti-Slip Company providing antislip treatments, non-slip products from mats & stair nosings to anti grafitti and cleaning solutions, reduce the risk of slips & fall accidents
Author: Discover Web Solutions
Anti Slip Products, No Skidding, Anti-slip tapes, Anti-slip coatings
Anti slip Products by No Skidding®: a leader in the manufacture and distribution of anti-slip products since 1993 including Anti-slip Tapes, Treatments, etc
Anti slip Coating aanbrengen? Ook andere antislip oplossingen
Anti slip Coating aanbrengen? Voor trappen, vloeren & vlonders. Nooitglad biedt veilige antislip oplossingen. ✅ Uitvoering, Reiniging & Onderhoud.
Anti Slip Floor Treatment In Singapore | Best Nano Anti Slip Coating
YHH Plus Enterprise offers high quality Nano Anti Slip Floor Treatment, Anti Slip Coating for tiles and Anti Slip Solution for slip resistant
Welcome to NoSkidSafety.ca - Canada - Anti Slip Treatments, Non Skid Coatings, Safety Tapes - Anti Slip, Reflective, Photoluminescent
Anti slip products ship from Canada, NoSkidSafety.ca offers a full range of anti slip products, anti skid coatings, slip resistant floor care, non skid treatments, Anti Slip Grit Safety Tapes, Anti Slip Vinyl Tape, Photoluminescent Tape, Reflective Tape.We offer a full range of anti slip coatings, slip resistant floor care, anti slip tape, glow in the dark tape, reflective tape. buy anti slip products online,anti slip products,anti slip, anti slip coatings,non slip products, anti slip product,a
Launceston Anti Slip Treatment
Anti Slip Network Tasmania specialises in Concrete Coatings in Launceston and provides Anti Slip Treatment and Tile Treatment.
Slip Cursus - Anti Slip Cursus | Alle Informatie Op Een Plaats :
Anti Slip Cursus .be Ben je van plan een Slipcursus te volgen? kijk dan op anti slip cursus .be en maak de juiste keuzen! Alle informatie op een plaats...
Anti Slip Flooring & Tile Treatment Brisbane | Anti Slip Coating | Non Slip Tile - Anti Slip
We specialize in Anti Slip flooring, coating & non slip treatment for tiles, floors, stairways, pools, spas, kitchen & bathrooms. Get free quote: 0421 340 204
Protective & Anti Slip Coatings | Non Slip Industrial Flooring
Non Slip Industrial Flooring supply and install non slip flooring including protective coatings and anti slip coatings. Free consultation.
Anti Slip Stair Nosing | Ceramabond Pty Ltd | Anti-Slip Products - Perth
Ceramabond has been manufacturing anti slip stair nosing for over 35 years. We are one of Australia's largest suppliers of anti-slip products. Call us today.
Anti-Slip Solutions, Pendulum Slip Testing
We provide anti-slip solutions to existing floors. We make floors non slip when wet. We Pendulum slip test floors and floor materials in situ and and house.
Tapefor - Anti slip tape, Glow in the dark tape, Marking tape ...
Anti Slip Anti Slip Tape Anti Slip Plate Anti Slip Coating More… We offer a complete collection of Anti Slip materials. You can choose between more than 10 types of Anti Slip Tapes in 15. different colors. Select the quality Anti Slip
Author: Admin
Home | Theyardhouse | Home Decor | Tablecloth Anti-skid, Anti-slip, Wipeable
Buy cotton tablecloth - hand block & screen printed - anti-slip, anti-skid and wipeable. Beautiful prints, drapes like cotton, but doesn't slip and is spill-resistant and wipeable. The Yard House. Made in India.
Anti-Slip Products in Australia - Safety Step International
Non-Slip Stair Treads & Anti-Slip Products Proudly Made in Australia Proven to be the toughest, longest-lasting, and best value anti-slip and safety stride stair nosing products in the world. So good, they come with a lifetime guarantee. Get a better grip with Safety Step .
Author: Steve Quinn
anti slip sokken, online shoppen, kindersokken, diabetes sokken, neon sokken, thermo sokken, kerst dekbedovertrekken, dekbedovertrekken
DE specialist in: sokken voor dames, heren, kinderen en baby's, waaronder ANTI SLIP SOKKEN, DIABETES SOKKEN en MISMATCHED SOKKENmaar ookDEKBEDOVERTREKKEN en kinderkleding -----------------------------------------------------------Wij bieden je de mogelijkheid om achteraf te betalen via Klarna. Hoe werkt achteraf betalen van Klarna?
Anti Fatigue Matting | Non Slip | Safety Mats | Pool Matting
Perth Safety Mats, Anti Fatigue Matting, Non Slip, Pool Mat, Anti-slip matting, Anti-fatigue matting Perth WA. Call OH&S Matting on 0419 923 385
Floor Safety Experts | Perth Anti Slip and Non Slip Floors
Prevent slip fall accidents by ensuring floors are safe. We are experts in anti-slip and non-slip floor solutions – making your workplace floors safer.
Non slip bath, Anti slip tapes & stair treads – Slips Away ®
Slips Away® offer a range of high quality non slip bath and anti slip tape products. Make your bathroom safer or a staircase more secure, contact us now.
Author: Junglemaster
Anti Slip Safety Solutions | Non Slip Products | Floorsafe NZ
Non slip stair nosings, deck grip, non slip tile & concrete solutions, grip tapes, line marking tapes and more. Buy online from the anti-slip experts.
Other sites like antislipsokken-vitaness nl
GripFactory - Innovative Anti-Slip Solutions for every Surface > GripFactory Anti-Slip Solutions
ANTI-SLIP SOLUTIONS - MANUFACTURER - WHOLESALE - FLOOR MEASUREMENTS - APPLICATION Anti-slip solutions for floors and stairs Every year millions of people end up in the hospital due to a fall due to slipping. Slippery floors due to moisture, chemicals or greases are a major cause of this type of
Author: Patrick de Koning
Wooster Products Inc.- Anti-Slip Safety Stair Treads, Non Slip Nosings, Tapes & Coatings
Anti-slip safety stair nosings and treads & non-slip walkway products including coatings and tape. We help you make every step a safe one. MADE IN THE USA.
Slip Resistant Flooring | Non Slip Floor Treatment | Anti Skid Coatings Material
Slip resistant anti-skid flooring for commercial, industrial & residential use products for anti skid floor safety. Slippery floor solutions provided for tiles, wood and cement surfaces for shower and bathtub to create anti-slip flooring solution.
Veiligheid voorop met Anti Slip - Anti-slip.nl
Voorkom vallen en uitglijden met anti-slip materiaal. Ongevallen op de werkvloer zijn helaas de orde van de dag. Haagh Protection biedt u de beste oplossing
Pro-Tech - polyurethaan anti-slip coating
Pro-Tech Coatings - polyuretaan anti-slip coating voor bijna elke ondergrond. Ook met UV-bescherming!
Stair Nosing and Anti Slip Stair Nosing Treads - Step On It
Step On It an Australian manufacturer of stair nosing, anti slip stair nosing treads, anti slip tapes, ladder rung covers and Tactiles.
WELLMAXX Anti-Aging Kosmetik - Hochwertige Kosmetik made in Germany
WELLMAXX cosmetics steht für: ✅ Hohe Anti-Aging Wirkung ✅Hochwertige Wirkstoffe ✅Qualität made in Germany ✅Produkte Dermatest geprüft ✅hohe Kundenzufriedenheit
Waterproofing & Anti-Slip Solutions | Nano-G Malaysia
We provide nanotechnology waterproofing solutions and anti-slip floor coating to prevent slips and falls at home. | No tile-hacking, Non-toxic, Noise Free!
Author: Joe Chang; Mia Chai
Safer Safety Ltd | Grip Anti-slip Footwear, Slip Resistant Shoes, Anti-Slip, Floor Marking Tapes, Matting, Masks and Earplugs
Manufacturer of Grip anti-slip footwear and also wellingtons. We supply both men's and women’s anti-slip footwear - athletic, dress, casual, work and safety shoes – for all industries including food service, hospitality, healthcare, grocery, travel, entertainment and industrial.
Author: Mike
Slip Resistant And Impact Absorbent Anti-Slip Surfaces from Rubaroc
Information about anti slip surfaces and impact absorbent surfaces suitable for walkways, golf courses, swimming pools and playgrounds etc.
Anti-Slip Stair & Floor Safety | Safe Tread
Safe Tread range of anti-slip stair and floor safety products
Author: Super User
GOLDHEIT - Luxus Anti-Aging Kosmetik und Hautpflege - Made in Germany
GOLDHEIT steht für luxuriöse Premiumkosmetik mit exquisiten, hoch effektiven Inhaltsstoffen ohne hochkritischen Inhaltsstoffen wie Parabene, PEG‘s, Mineralöle, Silikone und Mikroplastik. 100% vegan und ohne Tierversuche. Eine Anti-Aging Revolution, made in "Bavaria", Germany.
Bath Grip - Anti Slip Protection for Baths, Shower Trays & Wet Rooms
Anti-slip surfaces protection. Our unique product is independently Pendulum tested. Replace your mats for a permanent anti slip bath solution.
Stair Nosings | Antislip Stair Treads | Antislip Ladder Rung Covers | Advance Anti-slip Surfaces
Advance Anti Slip Surfaces specialises in manufacturing industrial anti slip stair nosing and stair treads, anti slip mats (safe plates) and non slip ladder rung covers. Based in Melbourne, Australia.
Made in Germany I Die offizielle Webseite | Made in Germany GmbH
Made in Germany Network ✓ Das offizielle Onlineportal der Made in Germany GmbH ✓ Fachmagazin ✓ Zertifizierung ✓ Unternehmensnetzwerk ✓
ALBILEX – Passivation is our passion. Antitarnish chemicals made in Germany.
Antitarnish-A-100 & PRO-KIT – Passivation / Anti-Tarnish Solutions for Metal Surfaces. Made in Germany. Made by ALBILEX.
non slip, tactile and anti slip floor surface treatment specialist - Global Safe Technologies (Australia)
Specialising in Non slip floor treatment to help reduce slip falls accidents. We have anti slip treatment solutions for wet, slippery tiles, concrete, around pools, kitchens, bathrooms and other surfaces.
Author: WEBTECH PRO - Website Design; E-Commerce; E-Business; Online Marketing Solutions - www webtech com au
Slip Gard Non-slip tile treatment use for creating an anti slip tile flooring for indoor and outdoor surfaces. The slippery tile treatment t
Slip Gard Non-slip tile treatment use for creating an anti slip tile flooring for indoor and outdoor surfaces.The slippery tile treatment that allows you to throw away your Bathroom mats.
TrialogEvent - Made in Germany
Made in Germany
Heelsafe Anti-Slip grates and covers | ACO Australia
Heelsafe Anti-Slip grates are used for a a range of internal and external applications. To help prevent public falls and injuries, small slotted grates should be slip resistant.
What else antislipsokken-vitaness.nl alternative websites
ProtectaKote Shop, sole official European distributor, lowest prices guaranteed, fast delivery, buy anti slip paint online - ProtectaKoteSho
ProtectaKote Shop, Sole European Official Distributor, Protectakote is a unique, advanced formula polyurethane anti slip paint, incorporating rubber granules to give a totally flexible antislip (nonslip) finish that will not flake, chip or peel.
Gleitringdichtungen made in Germany
Gleitringdichtungen made in Germany
jackpad24 - Wagenheber Adapter für TESLA - Made in Germany
Professionelle und hochwertige Wagenheber Adapter für TESLA, AUDI, BMW, MERCEDES, MINI, PORSCHE, SKODA, SEAT, VW u.v.m. - Made in Germany
Commercial Anti-Slip & Stair Nosing Solutions
StairCare provides a wide range of anti-slip safety solutions for all surface applications, from stair nosings to platforms, commercial to industrial environments.
Anti Slip Floor Safety Solutions in Australia | Slippery Tiles
Get the best Anti Slip Floor Safety Solutions in Australia to prevent up to 85% of all slip and fall accidents. Contact us right away to know more about us!
Made in Germany -
Die Bedeutung, Voraussetzung, Geschichte und das Logo als Download für Made in Germany Produkte.
Rubber Co - specialising in anti slip matting & flooring solutions
Rubberco.co.uk haveover 60 years of experience in the rubber matting & Flooring industry, specialising in anti slip matting & flooring solutions. It is our mission to manufacture and supply high quality Rubber matting & flooring at really good prices. We have a great range of Anti Slip Rubber Matting & flooring.
formliner, Compañero partner in tread patterns. Safety due to anti slip pattern and anti skid texture in concrete stairs, landings, balcony
formliner, Safety due to anti slip pattern and anti skid texture in concrete stairs, landings, balcony and access gallery. The Companero GIAN pattern mat provides the precast concrete with an anti-slip pattern
formliner, Compañero partner in tread patterns. Safety due to anti slip pattern and anti skid texture in concrete stairs, landings, balcony
formliner, Safety due to anti slip pattern and anti skid texture in concrete stairs, landings, balcony and access gallery. The Companero GIAN pattern mat provides the precast concrete with an anti-slip pattern
AATi | Anti-slip Stair Nosings, Treads and Associated Products
AATi are a leading UK manufacturer of cast metal anti slip nosings, treads and associated products.
passion for perfection – MADE IN GERMANY
MADE IN GERMANY
Le Slip Français - Vêtements Made in France
Le Slip Français fabrique des vêtements Made in France de qualité pour homme et femme: Slips, Boxers, Caleçons, Chaussettes, T-shirts, Pyjamas, Maillots de bain
Industry Standard for Anti Slip Treatments | Slipstop Australia
Slipstop is the leader for anti slip flooring solutions for Marble, Terrazzo, Granite, Porcelain, Vitrified, Concrete & Limestone with a 5-year guarantee.
The Smartkote Range - Anti-slip Floor Coatings - Smartkote
Smartkote is a comprehensive range of high performance anti-slip coatings for hard-working surfaces. Smartkote products are manufactured in South Africa.
Made in Germany Infoportal: fairs-made-in-germany.de
Made in Germany Infoportal: fairs-made-in-germany.de
sandraswerkstatt.de – kreatives made in germany
kreatives made in germany
Drahtziehlinien "made in Germany"
Henrich Maschinenfabrik GmbH - Drahtziehlinien made in Germany
Author: Henrich Maschinenfabrik GmbH
Food Made in Germany
Food Made in Germany unterstützt exportinteressierte Unternehmen
Anti-slip Technology Safety Stair Grip
Solutions for slippery steps and flooring. Anti-Slip & Way Finding Systems New Zealand. Safety Step is the leading expert in the provision of integrated pedestrian safety systems.
Dog Bandanas - Made with Love - Made in Germany - by Koko von Knebel
Dog Bandanas - Made with Love - Made in Germany
Other websites similar as antislipsokken-vitaness.nl
Anti Slip Mesh,Anti slip Mat,Yoga Mat Manufacturer and Supplier,Yoga Exercise Mat,Yoga Mat Manufacturer,Sticky Yoga Mat,PER yoga mat,medical
Anti Slip Mesh,Anti slip Mat,Yoga Mat Manufacturer and Supplier,Yoga Exercise Mat,Yoga Mat Manufacturer,Sticky Yoga Mat,PER yoga mat,medical grade mat,medical mat,shelf liner-Lansong manufacturerAnti Slip Mesh, Anti slip Mat, Yoga Mat Manufacturer and Supplier, Mat Manufacturer, Yoga Mat, Yoga Exercise Mat, Yoga Mat Manufacturer, Sticky Yoga Mat, Sporting Goods, Non Slip, medical grade mat, medical mat, shelf liner manufacturer, shelf liner.
flundr | Software made in Germany
Management Software made in germany
Optima Strings - Made In Germany | WELCOME
Optima Strings - Made In Germany | WELCOME
Wohnaccessoires und Geschenke Made in Germany
Wohnaccessoires und Geschenke Made in Germany
Author: INTERLUXE HOME ACCESSOIRES
Werner Fenstertechnik GmbH – Made In Germany.
Made In Germany.
ManuFaktUhr – Uhren und Lebensart – Made in Germany
Made in Germany
Author: Autor ManufaktUhr
Slipstop - Anti-Slip Shoes for Kids and Adults
– Slipstop.ae
Anti-Slip Slipstop safety shoes which you can use at the pool, beach, home, garden, school, play ground, boat, airplane, gym, pilates, yoga to avoid slipping with its non-slip, firm-grip soles. Also matching designs of kids swimwear, swimsuit, bikinis, swim-shorts, swim trunks, sun hats and UV50+ Rashguards for kids
Firehead10 Meldertaschen made in Germany
Wir fertigen hochwertige Meldertaschen made in Germany.
Author: Webhandwerk® Daniel Greco-Ahmadiyan
Gitarrenverstärker made in Germany
PCL Vintage Amp - PCL Audio - Gitarrenverstärker made in Germany
SkidProof - Anti-Slip Surface Solutions | Domestic & Commercial
Anti-Slip Surface Solutions We specialise in changing existing ‘slippery-when-wet floors’ to ‘safe to walk on-when wet’ floors. Slip Resistance Testing We conduct slip resistance testing and provide reports in Pendulum Test Values. Pre-works Cleaning We provide a pre-works deep cleaning service to remove detergent and other residue. Sometimes,
Some websites with similar theme to antislipsokken-vitaness.nl include:
WELKOM | Black Mamba Parts Shop
Heb je een vraag dan kun je me het beste bellen van 19 tot 20 uur op maandag tot en met Vrijdag. Gezien de 200 appberichten en meer dan 100 mails per dag ben ik niet eens meer in staat om die allemaal te lezen :(.
Paco's Damessjaal Wintersjaals | Paco's Bags & More
Prachtige dames wintersjaals in veel designs en veel kleuren beschikbaar. Kijk ook eens naar onze Sjaal Magneet Broches, te gebruiken in plaats van een sjaal speld.
Welkom bij de meest complete poortopenershop. | poortopenershop.com
“Het Gemak van een geautomatiseerde Poort”........En wij zijn al 30 jaar DE specialisten hierin...Met 4 jaar garantie..De Poortopenershop levert alleen A-klasse poortopeners voor draai- en schuifpoorten. Deze zijn er in verschillende types voor particulier en intensief gebruik.
Crystocraft | Shopping2Day
Origineel Spaans slaapkussen | spaanse kussens
De originele Spaanse slaapkussens vindt u bij Spaanse Kussens ©NL. De enige echte Spaanse slaapkussens in verschillende varianten.
Daanco bevestigingsmaterialen, voor al uw schroeven, boren, zagen etc.
U kunt bij ons terecht voor diverse soorten schroeven, zoals potdekselschroeven, hardhoutschroeven, gipsplaatschroeven, zelfborende schroeven, glaslatschroeven etc. Daarnaast bieden wij u de meest gangbare zaagbladen zoals decoupeerzaagbladen, oscilerende zaagbladen, reciprozaagbladen.
Bestellijst | Jinglestudio.nl
Welkom in de webshop van jinglestudio.nlIn onze webshop kunt u makkelijk en snel uw gewenste producten bestellen.We maken jingles met uw eigen tekst op maat maar ook hebben we een groot aanbod in standaard jingles en hitmixen.Ook voor het maken van radio commercials of sponsor spotjes bent u bij jinglestudio.nl op het juiste adres. Heeft u nog vragen neem dan gerust contact met ons op door te mailen naar Info@jinglestudio.nl Wilt u voorbeelden beluisteren van onze customade jingles klikt u dan hier.
www.SuperDuperDeal.nl | superduperdeal.nl
Bontkraag jassen Homepage | BamBella Bontkraag Jassen
Bekijk Alle Kinderjassen Jassen met bont kinderjas of Bontkraag Jassen mooie grote bontkraag kinderjassen winterjas met panterprint voor Dames Kinderen en Heren Zoek niet verder, wij zijn DE specialist in alle soorten jassen met een mooie imitatie bontkraag of een schattig zomerjasje Wij hebben het! Bekijk Alle KinderjassenBekijk Alle Kinderjassen Bekijk Alle Kinderjassen Bekijk Alle KinderjassenBekijk Alle KinderjassenBekijk Alle KinderjassenBekijk Alle Kinderjassen Bekijk Alle Kinderjassen
Inkt Cartridges | ReudinkSupplies.nl / Cartridges4u.nl
Ontvang 10% Korting! Bestel online en afhalen op de markt!
More other alternatives for antislipsokken-vitaness nl
SALE Accessoires | Alberts Tweewielers
Letop !!!! in November - December - Januari en Februari Zijn wij op Maandag - Woensdag - Donderdag en Vrijdag Om 17.00 uur Gesloten
Aanbiedingen | www.badkamerspullen.nl
Badkamerspullen,online,badkamerspullenOnline,sanitair,Wc,Bad,Actie,Douchekop,Drain,Nieuwebadkamer,Geberit,Plieger,Luxx,Grohe,Toilet,Toiletzitting,Badmeubels,Douchewand,Douchedeur,Spiegel,Douchegoot,Nijmegen,Wijchen,Venlo,Groesbeek,Goedkoop,Voordelig,Zano.
Handelsonderneming de Graaff, Hondenbenodigdheden | ho-degraaff
IVM een lockdown door de Coronacrises kan het iets langer duren voordat uw bestelde producten binnen zijn, vooral de stickers die niet op voorraad zijn (onbeperkt bestelbaar).Onze leverancier heeft aangegeven nog steeds te kunnen verzenden en wij gaan dan ook uit dat wij binnen de 15 dagen kunnen leveren. Welkom op de website van Handelsonderneming de GraaffExclusiviteit, betaalbaarheid en een breed assortiment zijn onze keywords.Wij richten ons voornamelijk op de huis-, en showhond en hun baasjes en zijn regelmatig te vinden op Kynologische evenementen in binnen-, en buitenland waar wij met onze evenementenstand staan.
Home | Verfstop.nl
Wij worden beoordeeld met een 8.8 Gebaseerd op 485 beoordelingen Kies een categorieDé online verfwinkel voor u Uitgelichte artikelenDit zijn onze best verkochte artikelen
WandelWol antidruk & voetzorgproducten | De Dames van de WandelWol
WandelWol antidruk-wol is toepasbaar op iedere voet die last heeft van pijnlijke drukplekken, blaren en ter preventie van de plekken waarvan je weet dat ze zullen ontstaan. Stop met datgene wat je doet.
CUSTOMWOODCREATIONS - Wij maken het Verschil!
Om een uniek, persoonlijk, cadeau te verwezenlijken mag u bij ons meedenken over het ontwerp of een eigen tekst en of logo aanleveren. Tevens hebben wij een ruim en trendvolgend assortiment in originele maar vooral persoonlijke cadeauartikelen, waarvan de meeste artikelen direct uit voorraad leverbaar zijn en naar wens kunnen worden gegraveerd.Heeft u speciale wensen, of bent u op zoek naar een bepaald product?
HOME | Led4wheels
Welkom by Led4wheels.nlWij verkopen verlichting en styling producten voor trucks bestelwagens, auto, tractoren,trailers enzWIJ HEBBEN EEN RUIM ASSORTIMENTWERKLAMPENTRUCKSTYLING PRODUCTENLED FLITSERS ZWAAILAMPENMARKERINGSVERLICHTINGBREEDTELAMPENACHTERLICHTENCONTOURVERLICHTINGLEDBARS ZONNEKLEPPENINTERIEUR STYLINGENZ AL ONZE PRIJZEN ZIJN INCLUSIEF BTW !
Welkom | ChromeIT
Welkom op de webwinkel van ChromeIT. Tegenwoordig gaat er veel digitaal en speelt techniek een enorm grote rol.
NasiVent Tube Plus | NasiVent Shop
Home | De Kralen Outlet
Bij Dekralenoutlet.nl vind je een ruim aanbod kralen en bedels voor een scherpe prijs.Zo bieden wij o.a. diverse houten kralen, facet kralen, metalen bedels, kinderkralen en nog veel meer.
Vers Vlees Hondenvoer Oss Wijchen Berghem Ravenstein Uden Grave KVV
123diepvriesvoer.nl is dé vers vlees + natuurlijke snack specialist in Ravenstein, Oss, Wijchen en wijde omgeving! Voor de niet-diepvriesproducten geldt: vóór 16.00 uur besteld, de volgende (werk)dag in huis (NL)!
Home | wakebox
Wakebox is een kleinschalige wakeboardshop met hart voor de sport: voor en door boarders!Uniek voor Nederland is dat we nieuwe en gebruikte wakeboards hebben. Met de ideale combinatie van een webshop én een fysieke showroom in Nieuwegein die op afspraak te bezoeken is.Hier kan je boards en bindingen komen passen, vergelijken, voelen, ruiken, buigen, checken waar de flex zit en vooral: persoonlijk advies krijgen.Wij weten -een beetje- wat er op de steiger speelt en hoe de boards zich in de praktijk op het water gedragen.
NIEUW! | Werk aan de Winkel
LIVE workshops!Eindelijk kan het weer!Waar we de afgelopen anderhalf jaar vooral online workshops hebben gegeven, kun je nu eindelijk weer bij ons aan onze Green Bar aan de slag!Totdat alles wordt vrijgegeven nog wel even met de Corona pas maar dus wel weer zonder 1,5 meter.Vragen? Bel ons in de winkel: 073-6121293 of stel je vraag per app: 06-44595509
Welkom bij Petscorner | Petscorner
Beste klanten van Petscorner.nl Petscorner.nl is van 26 oktober 2021 - 7 december 2021 gesloten wegens vakantie! Openstaande bestellingen worden uiteraard verwerkt.
Uw Online Winkel in Telefoongadgets | Oplaadkabels en Smartphone Accessoires | ActionPro
Oplaadkabel kopen? O.a. magnetische oplaadkabels, gripringen en telefoonhouders voor iPhone en Android-toestellen bestelt u online bij ActionPro.
Standaard broodjes | Lithsebakkertje
Let op afbeeldingen kunnen afwijken.
TyQu, voor al uw gepersonaliseerde kleding, kado's & meer..!
Welkom bij TyQu, de webshop voor al uw gepersonaliseerde kleding, schoenen, cadeaus & meer..! Tevens is TyQu het adres voor uw bedrijf bedrukkingen.
Start | anketissenshop
Vóór 12:00 uur besteld, zelfde dag verzonden GRATIS Proefjes cadeau, bij elke bestelling Veilig betalen via IDEAL!
Welkom | Modelauto DeJo
Welkom op mijn webshop Modelauto Dejo .Ik bied hier mijn schaalmodellen te koop aan die ik in de loop der jaren heb verzamelt en/of heb binnengekregen door inruil of inkoopDe prijzen bij mijn advertenties zijn vraagprijzen , bij interesse mag ook geboden worden naar waarde. Graag dit via de contact pagina of op facebook bij modelauto's: Welcome to my webshop Modelauto DejoHere I offer my diecast models for sale, which I have collected or exchanged.
INFO! | Cooperworld
Beste klanten en liefhebbers. Wij proberen alle onderdelen en Mini Parts op deze website up to date te hebben, door de Brexit en de Corona regels kunnen de levertijden afwijken van de service die u van ons gewend bent.
Welkom Scholtenslandelijkemeubelen
Scholtens Landelijke Meubelen is een webwinkel met alles wat u nodig hebt om een landelijke inrichting compleet te maken of een landelijk accent te geven. Lifestyle en industriële meubelen en accessoires rechtstreeks uit eigen import.