Top 100 alternative sites to compassconsultant.in
-
wysongconsulting.com
-
ofmsolutions.eu
-
reallifeconcepts.com
-
reallifeconcepts.co.za
-
axces.ch
-
trinityinfosystem.com
-
tatweer-intl.com
-
epagestore.com
-
evolucent.net
-
zugimpex.com
-
qadir.co.in
-
canwin.com
-
vplus.co.in
-
globalelitefinancialservices.com
-
blendfinance.com
-
delhiconsultancy.co.in
-
iamshubham.in
-
stemdot.com
-
successrocket.in
-
vetbrains.com
-
bolac.com.au
-
mprfs.com.au
-
archimedes.on.ca
-
sjabramsco.com
-
bmgindia.com
-
mconsulting.co.za
-
johnkapili.com
-
campbellrosecpas.com
-
bmcpa.com
-
vintconsult.com
-
smallbizconsultants.net
-
boothevassar.com
-
brianebarnett.com
-
hiyieldadvisor.com
-
daksh-consulting.com
-
challengermomentum.com.au
-
precisioninsurance.ca
-
mdlfinancial.ie
-
olatorera.com
-
opulence.net.in
-
mkwassociates.com
-
southeastbic.ie
-
gtiinfotech.com
-
prop3d.in
-
gmscomputers.com
-
comprehensiveacctg.com
-
solutionsask.com
-
lhconsulting.com
-
halfbrain.co
-
abci.hu
-
furacle.com
-
kellyiia.com
-
kfs.co.nz
-
kell.co.nz
-
compasscg.com
-
thecompliancecompany.co.nz
-
mudrawale.com
-
bizbriefcase.co.nz
-
smecastle.com
-
mkconsulting.in
-
bitjuno.com
-
erkfc.com
-
biruwa.net
-
clouditconsulting.com.au
-
wealthmakerfinancialservices.com.au
-
prosynergie.ch
-
creztinno.com.my
-
mka-consulting-group.com
-
netsole.net
-
auditorex.ru
-
ldesign.vn
-
sowatco.com.vn
-
certaimseguros.com.br
-
lifetimewealthpartners.com.au
-
coopcorreios.com.br
-
humanitas.ee
-
accountslab.com
-
novatour.com.ua
-
anayaconsulting.in
-
integral-info.ru
-
dater.com.br
-
ipa-ps.nl
-
solutionfinder.ae
-
ubgroup.vn
-
chinarfamilyresort.com.pk
-
kuysoft.com.tr
-
isafe.ie
-
theboulevards.co.za
-
oikosymb.gr
-
gdprtarsashaz.hu
-
submicrontechnology.com.my
-
servipoli.pt
-
markeza-group.com
-
capitaltree.co.in
-
samitechsolution.com
-
cloudware.ng
-
oratoriaemocional.com.br
-
galainvestltd.com
-
cassins.com.au
-
408090.ru
Weatlth Management, Estate Planning, Financial Services
wysong consulting llc is a wealth management company based in , providing asset management and personal financial services.
OFM Solutions
OFM Solutions provies a comprehensive range of outsourced financial services to IT companies, OFM Solutions provides and supports solutions designed to improve the financial managment of your business, OFM Solutions provide scalable solutions to finance i
Reallife Concepts | Positioning Insights & Business Solutions Consultants
We Consult, Coordinate, Activate & Invest, to provide insights and solutions for you and your business
Reallife Concepts | Positioning Insights & Business Solutions Consultants
We Consult, Coordinate, Activate & Invest, to provide insights and solutions for you and your business
Home | AXCES
AXCES provides Business Intelligence and Financial Solutions for small companies.
Trinity InfoSystem | Software Services | Home
Trinity InfoSystem is a formal company for software development. We provide software development, Training, and consultancy services.
Software Development Company Saudi Arabia | Software Consultants
One of the leading software development company in Saudi Arabia. Tatweer International provides financial solutions, IT and software solutions, software consultancy, IT infrastructure services and government based projects and services.
Author: Tatweer Intl Software Development Co
Website & Mobile app development Company | IT Services & Digital Marketing Solutions
EPAGESTORE is an website & mobile app development company in India - Gujarat. We are providing IT services with focus on web product development, customized business solutions, Digital marketing services and Online development center . Contact Us Now !
Evolucent Technologies - Home
Evolucent Technologies provides complete web-based solutions for business processes and e-services.
Zugimpex - company formation, corporate services, internationalization, business consulting
Our company provides financial consultancy for all type of businesses. Company formation, business consulting and other financial services.
Qadir - Web Hosting & Web Design service provider from chennai, India.
With offshore software development center in Chennai, India - Qadir consists of Indian software programmers & web developers for hire, working in php, .net, database management, providing agile business solution.
Canwin Technologies! – A Technology Services provider and a Product Development Company!
Welcome to the Canwin Technologies, A Technology Services provider and a Product Development Company based in India and United States.
Author: Www Canwin Com
vPlus. | Startup Business Consultants
vPlus. is a New Delhi Based group of professionals with an aim of providing end to end business planning, digital marketing & brand creation solutions to Indian small and medium businesses specially Startups.
Weatlth Management, Estate Planning, Financial Services - Reno, NV
global elite financial services is a wealth management company based in Reno, providing asset management and personal financial services.
BLEND FINANCIAL SERVICES
Blend Group of Companies has developed new ways of global management and financial consultancy to help deliver potent financial outcomes - Blend Finance
Delhi Consultancy,Placement Consultants in Delhi,Consultancy Services,Manpower Consultants India
Delhi Consultancy Services - providing Network Consultancy Services in delhi, we are offering Enterprise Solution, Corporate Training Services,Network Consulting Services in india, online Recruitment Agencies, Manpower Consultancy Services, providing Enterprise Solution services from india, wealso provide wide range of IT and HR consulting including onsite, offsite and offshore resources in delhi, Placement Consultancy company in india
eCommerce Consultants | eCommerce Business Consulting Services for Online Sales Growth
Jaipur based Ecommerce Solutions Company providing E-commerce Consulting, Shopify SEO SMO PPC & website Design & Development services. eCommerce Business Consulting Services for Online Sales Growth.
Author: Raj Kumar; Shubham Kumar
Stemdot Business Solutions Connecticut
Stemdot is a leading CT software development company that provides high-quality Software development services in Connecticut for you and your Business.
The Best Hosting Provider In India | SuccessRocket
SuccessRocket Is A Premium Business Services Provider. We Provide Hosting Services, Web Designing, Web Development, Mobile App Development, Business Management Consultant And Many More. Here You Will Learn To Start A Business And Grow It With The Speed Of Rocket. Our Support Team Work's 24x7 To Provide You Best Service Support.
Other sites like compassconsultant in
Part of Blade-BRAINS Group, Global. Delhi, India, South Aisa, Online Consulting, Virtual Presence, Innovation, Creation, Domain Registration
Online Consulting Business. Domain Registration, and Vetbrains is into Innovation, Creation and Execution of online marketing solutions. Website Design Company in Delhi, India offers web designing, SEO and website development. Website designing company in Delhi, India also provides professional and affordable web design development services from New Delhi, Web Design Company India and Web Application Development delhi providing world class solutions with latest techniques and current effective Internet Marketing Services and Digital Marketing Consultancy and Agency.
Bolac Enterprise Management Consulting
Bolac Enterprise provides consulting services aiming at Business Performance Improvement. We specialise in all aspects of management of a wide range of small to medium sized companies.
MPR Financial Services
MPR Financial Services provide accounting & taxation, business consulting, financial planning and investment advisory services to a range of business, self managed superannuation fund, investor and other clients.
Archimedes Systems Consulting Inc.
home page for Archimedes Systems Consulting Inc., an Ottawa-based software development consulting company
Author: Sean Casey
Weatlth Management, Estate Planning, Financial Services - Lincolnwood, IL
s.j. abrams & company is a wealth management company based in Lincolnwood, providing asset management and personal financial services.
Global Consulting Company, Top Management Consulting Firm
Indian division of the BMGI Global consulting company that provides management consulting services to companies based out of India and the Asia Pacific area.
Financial Consulting and Advisory Services - M Consulting
M Consulting, provides financial consulting and advisory services. We provide tailor-made business solutions to you to be leaders in your industries.
JohnKapili.com
JohnKapili.com! Programs Better Office Solutions. The company is a leading provider of services to individuals and companies. Home of Talking Calculator and Talking Math Tutor.
Campbell-Rose and Company CPA's - Mansfield, Ohio accounting frim offering iindivicuals and business consulting services.
Campbell-Rose & Company CPA’s is a Mansfield, Ohio-based CPA firm offering a wide range of accounting for individuals and business consulting services.
Author: Rob Napier
BMC CPAs and Trusted Advisors | New Smyrna Beach, FL | Home Page
Take a look at our Home page. BMC CPAs is a full service tax, accounting and business consulting firm located in New Smyrna Beach, FL.
VINT Consult
VINT Consult is a boutique consultancy developing A to Z solutions for business and government. The company provides consulting services in the following areas: Strategy, Operations, Finances, Marketing, HR, Business Planning, Digital.
Chicago, IL Business Consultants | Small Biz Consultants
A Chicago, IL based consulting firm that provides business council, web development, financial networking, and operations and logistics assistance.
Texas CPA | Big Spring, TX Accounting, Bookkeeping, Tax, Audit, Financial Planning & Business Consulting Services
Texas CPA firm providing accounting, bookkeeping, tax planning, tax preparation, financial planning, business consulting, and audit services for Big Spring and surrounding communities.
Weatlth Management, Estate Planning, Financial Services
hatrik investments is a wealth management company based in Enumclaw, providing asset management and personal financial services.
Weatlth Management, Estate Planning, Financial Services
raymond virgilio is a wealth management company based in Gulfport, providing asset management and personal financial services.
Home
Daksh Consulting Pvt. Ltd. ia a Pune based Financial Planning & Wealth Management boutique firm for individuals & families. It also provides Consulting services for corporates.
Challenger Momentum - IT Support & Custom Software Development in Melbourne
Challenger Momentum provides cost effective & comprehensive range of information technology (IT) services, including custom software development, outsourced IT support, IT consulting and technical support to small and medium sized businesses (SMEs) and home users. Our services are reliable, friendly and cost effective - try a free consultation today.
Author: Challenger Momentum Pty Ltd - Lobsang Negron
Precision Life Insurance Tax Consulting and Preparation Services Ontario Canada
Precision Insurance Services, an insurance and financial consulting, headquarters in Mississauga, Ontario, Canada serving Greater Toronto areas in Canada, provides life insurance, home insurance, travel, disability, insurances, retirement, financial, tax planning and tax return preparation.
Author: Precision Insurance Services copyright
Home - MDL Financial Consultants Ltd.
MDL Financial Consultants was established in 2004, as specialised providers of bespoke financial solutions for individuals, business owners and companies.
Author: Dermot McEvoy
Olatorera Consultancy Limited
Olatorera.com is a new-generation consulting company providing news and business development services to established companies and high net-worth individuals. Olatorera.com provides critical and analytical feedback to companies under our radar.
Author: Lara Carter
What else compassconsultant.in alternative websites
HR Consultant in New Delhi,Domestic Recruitment Consultant in Delhi
Opulence Consulting Group is a Fast Growing HR Company in Delhi,offering Placement Services in New Delhi,HR Consultant in New Delhi,Domestic Recruitment Consultant in Delhi,Domestic Career Consultant in New Delhi
Weatlth Management, Estate Planning, Financial Services
mkw & associates is a wealth management company based in Park Forest, providing asset management and personal financial services.
Home
South East Business Innovation Centre supports the generation and development of new innovative enterprises by providing tailored business consultancy services in Carlow, Kilkenny, Waterford, Wexford and South Tipperary.
Outsourcing, Offshore Development, Custom Development, IT Solutions
GTI Sofware is a offshore outsourcing company, a global provider of Offshore Outsourcing services and IT Solutions offers custom development, new development, new development, maintenance, porting, testing and much more.
Cognilements India
Cognilements, an Indian company which is based in Pune that enhances customer experience and delivers end-to-end solutions using Virtual Reality, Augmented Reality, Artificial Intelligence and also work in the space as a business consultant.
GMS Computer Consultants Home Page
GMS Computer Consultants provide products and services to meet all your small business and home computing needs including web page development, buildiing computers, networks, graphics and other computing solutions.
Comprehensive Accounting Services
Comprehehensive Accounting Services is located in St. Clair Shores Michigan and provides accounting, bookkeeping, tax, financial planning, business consultation and small business seminars. Our accounting service is designed specially for small businesses who are looking for an accountant that provides excellent service and personal consultation at a reasonable cost.
Accounting and Taxation Services,Internal Auditing Services,Financial Investment Consultancy
Accounting and Taxation Services - ASK Solutions providing services of Internal Auditing, indian Financial Investment Consultancy Services, Accounting and Taxation Service Company, Online Internal Auditing services, Accounting and Taxation services from india, Accounting and Taxation, Internal Auditing, Financial Investment Consultancy
Aviation consultants for airlines and airports
Lufthansa Consulting is an aviation and management consulting company dedicated to assist international clients from the aviation sector. We offer comprehensive consultancy and expertise to aviation clients: airlines, airports, governments, investors, civil aviation authorities, financial institutions and service related entities. Our aviation consulting services include Commercial, Operations, Finance and Transformation.
HalfBrain - IT Services | Consulting | Digital Transformation
HalfBrain is a Indian Conglomerate Company that provides next-generation digital services, consulting and business process services.
Author: Mr Rahul
Advocate Business Consulting | IT Consulting and
Development Services
Advocate Business Consulting - IT Consulting and Development Services for the Financials and Pharmaceuticals industry
Software & Mobile App Development Company in Delhi
Furacle is a Global IT Company in Delhi India Provides Consulting Services, Application Software Development, Digital Marketing, Cloud Solutions, E-commerce Development and Customized Business Soltuions.
Weatlth Management, Estate Planning, Financial Services - Los Angeles, CA
patrick kelly independent insurance agent is a wealth management company based in Los Angeles, providing asset management and personal financial services.
Kiwi Financial Services - Tax Refunds, Tax Credits, Accountancy Services, Financial Planning
Kiwi Financial Services - tax refunds, tax credits and accountancy services and solutions for individuals, small businesses, investors and family trusts in New Zealand.
Author: ViewBuild Virtual Marketing; Websites; Graphic Design Visit us; Www Viewbuild Co Nz
Welcome! - Kell Consulting Limited
Welcome to the website of Kell Consulting (New Zealand) Limited! We are a Christchurch based consulting firm that provides strategic services to our clients in business development and information technology. Our goal is to...
Compass Consulting Group, Inc,
Compass Consulting Group is a consulting and market research firm to financial institutions primarily in New England. We are located at 38 Transit Street in Providence, Rhode Island.
Specialist AML/CFT and Compliance Consultants
Specialist Compliance and AML/CFT consultants based in Auckland, New Zealand. We provide Compliance and AML/CFT services to businesses operating in the financial service and credit industry in New Zealand. ...
MudraWale.com, finance consultants Delhi, investment consultants Delhi, finance investment companies, investment finance companies, finance
Mudrawale.com is the official website of finance consultants Delhi, investment consultants Delhi, finance investment companies, investment finance companies, finance investment consultants, investment finance consultants, business finance consultants, corporate finance consultants, business investment consultants,
Author: Delhiwebsitedesigning com; Sagar gaur
BizBriefcase | Business Consultants Australia and New Zealand
BizBriefcase is a Business Consulting Agency based in New Zealand. We specialise in Team Building, Leadership Development, Sales and Customer Service Coaching, and Personal Development. We offer business advice and consulting to companies in Australia and New Zealand.
Author: Dylan Wilson
Egyptian business management consulting company for startups
Egyptian business management consulting company for startups & entrepreneurs provides business management, accounting & financial services.
Other websites similar as compassconsultant.in
Business Consulting Agency | Business Plan Consultants - MK Consulting
MK Consulting is the best business consulting agency providing solutions to businesses in web services, technology space, and development to improve their web presence.
Bitjuno || Welcome to IT Consulting Agency
Technology consulting, IT outsourcing, technology services, it service provider, technology solutions, software consulting,software development outsourcing, software development services, offshore software development, IoT, cybersecurity, digital transformation, automation, business analytics, application development, IT Services, Business Consulting, IT outsourcing, digital solutions
ERK Financial Consultants, Inc.
Take a look at our Home page. ERK Financial Consultants is a full service tax, accounting and business consulting firm located in Glendale, CA
Biruwa Advisors - Management and Business Consulting for Entrepreneurs
Biruwa Advisors is a management and business consulting firm focused on providing services to entrepreneurs, startups, SMEs and corporate houses.
Cloud IT Consulting | Website Design and Develop | IT Consulting and Solution
Cloud IT Consulting is an Australian company based in Sydney, which offers professional IT consulting services. Our services include website design, website development, mobile app development, eCommerce solution, IT consulting etc.
WealthMaker Financial Services | Wealth Creation and Management
WealthMaker Financial Services (WMFS) expert mortgage brokers & financial planners who provide clients with personalised home loan, financial and retirement planning recommendations based on their individual financial goals. Call WMFS today on 02 9233 1111.
Home - ProSynergie Consulting
We Make Your Business Ideas Come True We are a Swiss-based company providing IT Solutions & Business Consulting Services for 20 years Read More Read More Tailored IT Solutions We help businesses elevate their value through custom software development, QA and consultancy services. We carry more than just good coding skills. Our experience makes us stand […]
Some websites with similar theme to compassconsultant.in include:
Creztinno Technophiles – Connectivity Builds Relationship – Connectivity Builds Relationship
🥇 Mka Consulting - Web Agency Marketing Digital - création site internet application web - référencement - Agence conseils Congo Rdc
Mka Consulting Group vous accompagne dans votre stratégie digitale de visibilité sur internet et développement de trafic qualifié. Contactez votre agence conseils Web marketing à Kinshasa (Congo Rdc web agency communication) pour des solutions e-marketing adaptées à vos besoins (création site internet plateforme, application web intranet/extranet, référencement SEO, SMO, Pay-per-Click, gestion de base de données, optimisation process gestion relation clients ...) que vous soyez une société ou une organisation publique (administration, régie, entreprise publique, parti politique, une personnalité, organisation religieuse ...).
Solutions For critical needs. Infrastructure, Cyber Security, DR & Continuity, IT Management.
Главная ⋆ Аудитор.Эксперт - Auditor.Expert
L Group Company – Chất lượng tạo nên Uy tín
SOWATCO – Tổng Công ty CP Đường Sông Miền Nam
Certaim Corretora de Seguros em Porto Alegre
A Certaim é uma corretora de seguros localizada na cidade de Porto Alegre. Contamos uma equipe altamente qualificada a Certaim é a empresa certa para assegurar a máxima qualidade em todas etapas de relacionamento com o cliente. Do momento da contratação de sua Apólice, até o assesoramento completo nos casos de sinistro.
Lifetime Wealth - Financial Advisers & Planners - Redcliffe
Whether you are thinking of retirement or looking to buy your first home our expert financial advisers can assist you to achieve your goals.
Coopcorreios – O Associado em Primeiro Lugar!
O Associado em Primeiro Lugar!
Humanitas - vabamaadlus, Kreeka-Rooma maadlus ja naistemaadluse õpe
Maadluskooli eesmärgiks on edendada laste- ja noorte sporditegevust. Vabamaadlus, Kreeka-Rooma maadlus ja naistemaadlus Pärnus ja Pärnumaal
Online Cloud Accountants & Tax Advisors | Xero Certified | Accounts Lab
Cloud accountants and tax advisors saving businesses time, money and boosting growth. Xero, Quickbooks and Receipt Bank certified. Join us today.
Турагентство «Новатур»
Anaya Consulting – MIDC Consultant – Advisory & Approvals
More other alternatives for compassconsultant in
Автоматизация бизнеса. Обслуживание техники | Сервисный центр
Ремонт компьютеров. Ремонт ноутбуков. Выезд инженера. | Сервис-центр ИНТЕГРАЛ-ИНФО. ул. Г. Десантников 47. Пн.-Сб. ☎ +7-9887-621-024. Различные формы оплаты.
Author: Андрей
home – Dater Tecnologia Web e Sistemas, Aplicativos, Sistemas **** Medida, Marketing Digital, Assessoria... em Redenção-PA
IPA - Projects and Services
IPA is synonymous to automisation and assembly processes. IPA can improve any production process, often through special machines and (high-end) lines.
Solution Finder – We build, facilitate & promote your business
UB GROUP JOINT STOCK COMPANY
Chinar Family resort – Welcome to Chinar Family Resort
Kuysoft – Kuysoft Bilişim Hiz. ve Tic. Ltd. Şti. Web Sitesi- Sadece Hayal Et!
Health and Safety Courses | Health and Safety Consulting | iSafe.ie
We offer a range of health and safety consultancy and recruitment services. Call us today to discuss your company’s needs.
The Boulevards – Residential Complex in The Vaal
Συμβουλοι επιχειρησεων θεσσαλονικη - Οικονομική Συμβουλευτική
Συμβουλοι επιχειρησεων θεσσαλονικη- Οικονομική Συμβουλευτική, 20 χρόνια εμπειρίας στην οργανωση λογιστηριων, επενδυτικα προγραμματα, φορολογια, μετατροπες-συγχωνευσεις
GDPR Társasház – GDPR Társasház
Author: Adnetmedia
Semiconductor Repair & Parts | Nikon Stepper Parts | New, Used & Refurbished - Submicron Technology
SERVIPOLI – SERVIPOLI Consultoria
Markeza Group for Entrepreneurship – Integrated Web Solutions
Capital Tree Financial Solutions: Your Financial Advisor
CAPITAL TREE is a Financial and Corporate Consulting firm focused on providing most qualitative and value-added solutions to its clients as their internal resource.
SAM ITech Solution
Home - CloudWare Technologies
We integrate IT Solutions to Solve Business, Public and Social problems. Software, Web app, mobile app Development, Systems integration, Trainngs, Consulting
home - Instituo IOE
Desenvolva a habilidade de interagir em público. Seja no cenário corporativo ou social. Instituto IOE - Cursos de oratória ligue: (61) 9 9836-6464 Brasília DF. Pessoal e corporativo. Fale e conquiste espaço!
Gala Investments Ltd – Non of its Kind
Cassins Healthcare Design & Construct - Medical Fitout Sydney
СЦ "АйТек" – IT-АУТСОРСИНГ
