Top 100 alternative sites to dupreezfs.co.za
-
noblefinancialgroupllc.com
-
bfsolutions.com
-
mc2investmentadvisors.com
-
guidestone.org
-
flodderfinancial.com
-
grassofinancialservices.com.au
-
wealthmakerfinancialservices.com.au
-
futurefinancialservices.com.au
-
durbanpestcontrolservices.co.za
-
ffib.ca
-
watermark-financial.com
-
vukars.co.za
-
ceponisfinancialgroup.com
-
rafrom.com
-
hpofire.co.za
-
barnestaxservice.com
-
edsuplan.com.au
-
aumento.co.in
-
remingtonadvisors.com
-
jagoinvestor.com
-
fsonline.com
-
wealthwiseplanning.com.au
-
howthfinancial.ie
-
kingdomfs.co.nz
-
maximumwealth.com.au
-
hqbfs.com.au
-
vfsco.in
-
beeliarfinancialadvisers.com.au
-
consumersfinancialservices.ca
-
rcfinancialsvcs.com
-
actionin.com
-
fundpulse.com
-
adrianspoolservices.com.au
-
listerfs.com.au
-
glicogroup.com
-
primefinancialservices.org
-
mapsfinancial.com
-
jgfr.com
-
zorba.com.au
-
paccarfinancial.com.au
-
barnsfinancial.com.au
-
lionandshield.com.au
-
buyisasecurity.co.za
-
bfsfinance.com.au
-
paymentmetrics.com
-
geckogroup.co.za
-
waynemah.ca
-
tab.ie
-
trihead.co.za
-
dudleysbalancing.co.za
-
cutcher.com.au
-
mconsulting.co.za
-
lesemannins.com
-
lesemanninsurance.com
-
myifs.net
-
gjrfinancialservices.com.au
-
goldsborough.com.au
-
wayneschevron.com
-
fellerfinancial.ca
-
chitwoods.com
-
sist.co.in
-
cmcagroup.ie
-
hoyekfinancialservices.com
-
mlendfinance.com
-
mcgills.ca
-
adv.ie
-
probank.com
-
dreamdestination.co.za
-
bromelainsa.co.za
-
cga.co.za
-
lloyd-warren.co.za
-
myfax2email.co.za
-
protalent.co.za
-
umongo.co.za
-
hinghamnursery.co.za
-
fairiedene.co.za
-
greystonesaviation.co.za
-
verveplacements.co.za
-
durbanfloralart.co.za
-
maxscott.co.za
-
afriscan.co.za
-
automation.co.za
-
habandbf.co.za
-
glassfibreproducts.co.za
-
inkosiauto.co.za
-
dbnsouthpanelandpaint.co.za
-
permaculture2012.co.za
-
irstronics.co.za
-
webhousegroup.co.za
-
dawsonsst.co.za
-
beierenvirotec.co.za
-
ccpas.com.au
-
millenniumbridge.co.za
-
urtc.co.za
-
unser.co.za
-
umfolozisugarmill.co.za
-
kznprojectengineering.co.za
-
camelotspasanlameer.co.za
Noble Financial Group | Advisers For Life | Lucas Noble
We provide a full array of comprehensive personal and business financial services. Feel free to contact us for a complimentary initial consultation or brief introductory conversation to determine how we might collaborate with you toward achieving your financial goals. Lucas Noble
Becker Financial Solutions
Becker Financial Solutions, located in South Windsor, CT offers services covering all areas of financial management, from investment and retirement planning to risk management and estate conservation. We specialize in helping our clients develop a comprehensive, cohesive financial plan that fits their unique needs and enables them to work towards both short- and long-term objectives.
MC2 Financial Advisors | Investment Advisor for retirement and estate planning, CFP
We are a fee-only financial and investment advisory firm in Newtown Square. CFPs and CPAs offering investment management and tax planning services.
Financial Services & Insurance Solutions
Financial Services & Insurance Solutions Providing diversified benefits, investments and protection guided by Christian values
Financial Planning Services in Houston | Flodder Financial Group
<p>Flodder Financial Group's financial professionals provide financial planning services for the Houston community, including annuities, brokerage services, estate planning strategies, insurance, investment planning, long term care and retirement.</p>
Grasso Financial Services | Home
Grasso Financial Services provide financial advice and planning to the Burdekin region including Ayr, Bowen, Home Hill and Giru.
WealthMaker Financial Services | Wealth Creation and Management
WealthMaker Financial Services (WMFS) expert mortgage brokers & financial planners who provide clients with personalised home loan, financial and retirement planning recommendations based on their individual financial goals. Call WMFS today on 02 9233 1111.
Future Financial Services | Penrith | Sydney | Financial Planning |Retirement Planning, Wealth Creation, Superannuation Advice | Insurance P
Future Financial Services Emu Plains - Penrith provides; Retirement Planning, Wealth Creation, Superannuation Advice & Insurance Planning Advice. We are a boutique financial planning firm, we are dedicated to providing personalised, easy to understand advice as our clients go through various life stages. Operating throughout Western Sydney, with bases in Concord & Penrith.
Author: Future Financial Services
Home - Durban Pest Control Services
who are we and what do we do? We are a company that has been in operation for 30+/- years and specialise in pest control services. We operate within the Durban, Kwa-Zulu Natal area and can help you with all your pest control solutions. We constantly
Author: Administrator
Fledderus Financial | Insurance and Financial Products | Belleville, Ontario
We provide insurance and financial solutions for a variety of risks and needs. With over 20 years experience and access to some of Canada's top insurance markets, we offer quality insurance recommendations at competitive rates.
Watermark Financial Planning, Swansea - For the Flow of Wealth
We provide wealth management and financial planning services throughout the UK, tailored to the needs of our clients.
Author: NetBop Technologies; Www Netbop Co Uk
Vuka is a financial services provider. Vuka Risk Solutions.
Vuka is a financial services provider with competencies across all employee benefit disciplines. We offer complete independence between all service providers.
Ceponis Financial Group | Financial Management in Ridgefield, Connecticut | Serving Clients Throughout Fairfield and Westchester Counties
Ceponis Financial Group is a full-service advisory firm located in Ridgefield, CT. The firm provides a complete range of financial services which includes retirement planning, investment planning, and wealth management through a fee-based structure. Our team works with individuals as well as business owners in Fairfield and Westchester County. We continue to uphold client relations across the globe. Ceponis Financial Group is here to make sure you and your money have a mission.
RR Financial Services
RR Financial Services mission is to provide industry leading insurance, brokerage and consulting products and services. We provide excellent products and recommendations including life insurance, income protection, mortgage protection and pensions.
Author: KW Solutions
Home - HPO Fire Consultants
HPO Fire Consultants is a specialized fire-management service provider, based in Kwa-Zulu Natal, with an excess of 20 years’ experience covering all sectors of industries.
Home - Barnes Tax Service
We provide first class investing, tax planning, payroll, and insurance planning services. General bookkeeping and personal financial services. Tax preparation and life settlements.
Edsuplan Financial Services - Superannuation - Financial Advice - Investments - Retirement - Home
Edsuplan Financial Services has a proud history of developing financial strategies to help build and protect wealth. Specialising in cash flow management and debt reduction strategies, Edsuplan has been a trusted source of financial advice for Victorians for 34 years.
Aumento Corporate Solutions
Aumento finance mumbai, Aumento mortgage mumbai, Aumento loan mumbai, Aumento Corporate Solutions mumbai, finan
Aumento Finance, we are Leading PRIVATE FINANCE AND Financial Consultants in Mumbai providing financial and professional consultancy services to esteemed clients who are High Net Worth Individuals, Partnership Firms, Private Limited and Limited Companies all over India.We arrange and advance financial assistance from private banks, nationalized banks, financial institutions, private lenders etc, against mortgaging of immovable properties like Commercial Building, Business Premises, Cinema Hall, Hotels, Shops, Factory, Industrial Units, Ownership Flats, etc. Below are our products, terms and conditions along with procedure and a list of documents required.
By-The-Hour, As-Needed, Fee-Only Financial Planning - Remington Advisors, Inc.
Remington Advisors is a fee only financial planning firm. We don&#39;t charge commissions on your investments, and we don&#39;t accept fees or payments from the companies in which you invest. All we charge is a fee to our clients for the services we provide. This allows us to maintain our objectivity. We are located in Albuquerque, NM. You can reach us at 505-332-2500, or at info@remingtonadvisors.com.
Other sites like dupreezfs co za
Online Financial Planning service in India - Jagoinvestor
Jagoinvestor is one of the best and most trusted online financial planning websites in India. We provide mutual funds, financial planning and insurance services.
Financial Services Online
Financial Services Online has been providing growth and retention marketing services to the Financial Services industry since 1995.
Cathy Rademeyer
Cathy Rademeyer has been involved in the financial services industry for the past 10 years holding senior positions including Operations and Human Resources Manager.
Mortgages - Pensions - Investments - Protection - Howth Financial Services
Howth Financial Services has 50 years of experience in the financial services industry. We provide you with expert advice for all your financial needs
Author: Ann Slein
Complete Financial Solution | Kingdom Financial Services, Auckland
Think different- Think Legacy - We offer Complete Financial Solution to our clients providing financial services. We offer a detailed financial analysis, Budgeting, Cash Management, Drafts of wills, Life Insurance , Health Insurance , Disability Income, Mortgage Protection Cover, Mortgage applications, Kiwi Saver. Third Party Quotes on Home, Contents, Vehicle and LIability Insurance
Maximum Wealth Advisers - Financial Services Adelaide
Maximum Wealth Advisers was formed over thirty years ago as a small, boutique firm, providing a full range of financial services and advice to both private individuals and small to medium sized enterprises.
Financial Planning & Advice Coffs Harbour - HQB Financial Solutions
We offer financial planning, advice and wealth management throughout the Coffs Coast. HQB Financial Solutions has been providing first-class financial services for Coffs Harbour and surrounding residents for over 10 years.
Home | Volvo Financial Services
We are the global financial services provider for the Volvo Group. We provide a full range of financial services for the truck, construction equipment, bus, and marine industries.
Beeliar Financial Planners - Beeliar Financial Advisers
Beeliar Financial Advisers aim to be your one-stop shop for all your financial needs. We have been providing a spectrum of financial services to Australians for the past thirty years. Whether you want to plan your retirement or create a budget, we’ve got your back. We have survived this long due to our strong customer-centric …
Consumers Financial Services | Accounting Services in Thunder Bay
Consumers Financial Services has been helping people in Thunder Bay for over 40 years now. We provide the best service for our clients. Contact us today.
Tax Preparation Services | RC Financial Services
With over 30 years' experience, RC Financial Services has been providing tax preparation & accounting services to clients throughout Metro Atlanta.
Action Insurance Service / Business, Auto, Home Insurance / Utica MI 48317
For over 50 years, Action Advantage Group has been delivering insurance and financial services. We are committed to a high standard of excellence in all that we do & establishing a firm relationship of mutual trust & service with each of our clients.
Author: Action Insurance Service; Business; Auto; Home Insurance; Utica MI
Fundpulse is Financial Software
Fundpulse is a software provider specialised in automation and Straight Through Process technology to support the front, middle and back office. We partner with buy- and sell- institutions to customize and develop software tools that help them cope with increasing regulations in the financial sector. Since 2010 we have been helping our customers automating their trading lifecycle process and developing true Straight Through Processing (STP) platforms. We aim to minimise or even eliminate manual intervention which translates in accurate reporting, fewer data errors and streamline operations.
Home - Adrian's Pool Services
At Adrian’s Pool Services, we understand that you want your pool to look, feel and be the best it can be. We are a family owned and operated business with over 25 years of industry experience and have been providing comprehensive, quality servicing for residential and commercial pools within Northern NSW and the Gold Coast for the ****+ years.
Author: Caroline; Tugun
LISTER FINANCIAL SERVICES - Financial Advisers
We can help you. Why Lister Financial Services..... I've been with Lister Financial Services for over 4 years now and whenever I've needed help and guidance I've got the help and service I've needed and more.
Author: Lister Financial
Home
Welcome to GLICO We are Transparent, Trailblazers, Leaders, Dependable, Corporate Citizens, Customer-Focused, Dedicated, Forward-Thinking GLICO is a household brand and a leader in the insurance and financial services industries in Ghana. For over 30 years, we have been leading with innovative insurance and financial solutions. Our subsidiary companies have been creating a ‘Better Tomorrow’
Prime Financial Services - Home
Prime Financial Services has been assisting healthcare providers for over 20 years with the revenue cycle process.Our services include:Bad Debt ProgramsEarly Out ProgramsProfessional BillingConsulting Services
MAPS | Beyond Financial Services
Welcome to Financial Solutions new era For over 25 years, we have been investing in innovation, knowledge and service excellence to provide specialized technology on full-solutions for banking, asset management, insurance companies, financial services and risk management. Take your next step Beyond Financial Services MAPS Financial practices delivering valuable solutions to its customers through innovation,…
Financial Services Market Research
John Gilbert Financial Research (JGFR) provides monthly and quarterly reports on UK consumer confidence and financial activity. We also operate a financial research, information and consultancy service.
A little about us - Zorba Financial Services
Zorba Financial Services is a leading specialist accounting, compliance, consulting services and management business, dedicated to the hospitality industry. And we mean dedicated! We live and breathe all things hospitality and our passion for the industry shines through in everything we do. We have been providing value-based financial solutions to pubs (hotels), clubs, accommodation hotels, …
What else dupreezfs.co.za alternative websites
Home - PACCAR Financial
PACCAR Financial is your dedicated financier of Kenworth and DAF trucks, offering customised financial solutions, specialised products, and service excellence to the road transport industry. Operating in Australia for over 35 years, PACCAR Financial understands your business and the industry in which you operate. We are not a bank, but a specialist finance company financing trucks and trailers.
Barns Financial Services
About Us Barns Financial Services is an privately owned and operated organisation. Being self owned and self licenced and free from ownership to financial institutions we are able to provide our clients with the best service with the best product available. Our aim is to provide a Financial Planning and Wealth Management
Author: Admin
Lion & Shield Insurance & Financial Services
We are a locally owned and operated financial and insurance service provider based in Toowoomba. We service regional and rural Queensland providing a range of personal and business products and services.
Welcome to Buyisa Security Services - Buyisa Security Services
We provide a Committed, Responsive and Excellent Guarding Services Buyisa Security Services has been in operation since 2013 It is committed to services excellent. We are aiming of being on who plays the leading role in reducing crime from residential, shops, malls, industries and government . Buyisa Security Services operate in Kwazulu Natal. We have […]
Binding Financial Services - The Freedom to Choose
bfs financial services has over 30 years hands-on experience in the Finance and Banking industry. We personalise finance.
SERVICING THE INTERNATIONAL FINANCIAL SERVICES MARKETS
Our clients receive the most knowledgeable financial services consulting we can provide. Reach out to our management consultants for operational advice.
Gecko Group – Gecko Group
GECKO GROUP Celebrating 10 years of leadership in the transport industry. Gecko Group was born from humble beginnings in 2006 out of a small startup in Durban, Kwa-Zulu Natal. Today, we boast a diverse fleet, with heavy duty capabilities, able to move goods locally, through Africa and beyond. We are committed to helping trade
Author: Geckogroup
Home - Wayne Mah - Citywide Mortgage Services
Wayne Mah, mortgage broker, helping you navigate the tricky world of mortgages. Since 1995 Wayne has been committed to providing unparalleled service to his clients. His patience in listening to his clients’ needs and desires, the commitment to ensuring that these needs are met efficiently, and his ability to be flexible with his schedule are just a few of the compliments that he has received from clients over the years.
Author: Rol Fieldwalker
TAB Taxation Advice & Financial Services - Dublin
TAB Taxation and Financial Services provide an end to end solution to your financial needs under one roof. We have served our clients for over 20 years.
Financial Services & Financial Solutions providing multiple product services
Your Content Goes Here Your Content Goes Here We, at TriHead Financial Services, aspire to listen. Your needs matter. With over 30 years’ experience as Independent and Unbiased Financial Services Providers, and supported by technology, TriHead Financial Services offers you appropriate solutions in the fields of Investments, Pensions,
Author: Titanic
Dudley's Balancing
Our intention is to be the number one stop for dynamic and static balancing in Kwa-Zulu Natal. We would like to take this opportunity to inform you of the change of ownership of Dudley's Balancing after 40 years of being owned and successfully managed by Dudley Lawson. His untimely death will leave a void in the industry. We guarantee to offer the same degree of excellence and service that has been maintained by Dudley's Balancing over the last 40 years.
Home | Cutcher & Neale Accounting and Financial Services
With over 65 years of industry experience, Cutcher & Neale are a leading provider of accounting and financial services based in Newcastle and Sydney CBD.
Author: Cutcher; Neale
Financial Consulting and Advisory Services - M Consulting
M Consulting, provides financial consulting and advisory services. We provide tailor-made business solutions to you to be leaders in your industries.
Lesemann Insurance Agency, LLC / Auto, Home, Business Insurance / Charleston, NC 29407
Lesemann Insurance Agency, LLC has been family owned and operated since 1936. We are a true full service insurance agency offering Auto / Home / Commercial / Life & Medical Insurance. Lesemann Insurance Agency, LLC has been proudly serving the insurance needs of Greater Charleston residents and businesses for the past 76 years.
Author: Lesemann Insurance Agency; LLC; Auto; Home; Business Insurance; Charleston; NC
Lesemann Insurance Agency, LLC / Auto, Home, Business Insurance / Charleston, NC 29407
Lesemann Insurance Agency, LLC has been family owned and operated since 1936. We are a true full service insurance agency offering Auto / Home / Commercial / Life & Medical Insurance. Lesemann Insurance Agency, LLC has been proudly serving the insurance needs of Greater Charleston residents and businesses for the past 76 years.
Author: Lesemann Insurance Agency; LLC; Auto; Home; Business Insurance; Charleston; NC
M&Y International Financial Services | New Brunswick | NJ | Home
For eleven (11) years, M&Y International Financial Services has been providing quality low-cost tax preparation, accounting, and business services for its cliet
GJR Financial Services
'Offering real commercial value in an efficient and effective manner' is our objective at GJR Financial Services. We pride ourselves in providing personal attention; we are in contact with you throughout the year and not just before or after year-end.
Financial Planning Adelaide | Goldsborough Financial Services
Goldsborough specialises in providing personal financial planning services to individuals. Our firm has been operating since 1992 and has clients from the city and regional areas of South Australia as well as a number who live interstate or overseas.
Wayne's Service Center Chevron Foodmart » Auto Repair Normandy Park, Seattle
Making Every Customer Feel Like Family! Wayne Roush, founder Experience You Can Trust We are a locally owned Chevron Foodmart store and gas station, with a four bay service facility and accredited mechanics with years of experience. Established by owner Wayne Roush in 1965, we have been doing the right things for 50 years - ...
Feller Financial | Insurance and Financial Service + Solutions | Campbell River
At Feller Financial Group we provide personalized financial service and solutions to individuals, families, and small businesses. Using our five point financial plan, we provide the guidance to see you through the process of preparing, planning, protecting, and prospering to achieve financial peace of mind, today, tomorrow, and for years to come.
Other websites similar as dupreezfs.co.za
Chitwood & Chitwood | Financial Services For The Ministry
At Chitwood & Chitwood we utilize our 80 years of combined experience to provide financial services for churches, ministries, & non-profits.
SIST
Stabilizers Industrial Services and Trading (SIST) is a successful trading and services provider in the industrial sector operating in Kerala for the past 20 years. We are dedicated to providing quality services to a plethora of industries in India and overseas.
Engineering Services - Conor McCarthy & Associates Chartered Engineers - Home - Engineering Services
Conor McCarthy & Associates has been providing professional engineering services to over 10 years. We will be happy to discuss your engineering requirements for residenial, industrial & commercial projects.
Hoyek Financial Services – Estate and Financial Planning – Since 1991
Hoyek Financial Services is an independent agency that have been providing all types of insurance and financial needs since 1991. We use the best research and technology to identify and invest in top rated companies.
Author: Pete Hoyek
M-lend Financial - Home
Welcome to M~lend Financial, for over 20 years we have offered patient and consumer financing services throughout the country.We’re unique for the industry in that we chargeno fees or have discounted paymentsto the providers. Doctors, clinics, hospitals
Home - McGill's Industrial Services
Saskatoon Industrial Services McGill’s Industrial Services Inc. have been leaders in the industrial cleaning industry for more than 50 years. As a family owned and operated business, we provide a range of services to keep your commercial and industrial operations running as efficiently as possible. Our comprehensive services include the following: Hydro Vac Excavating High-Performance Industrial...Read More
ADVANCE Financial Services - Providing FREE Financial Advice
At Advance Financial Services we have over 85 years industry experience and we offer advice in the insurance and mortgage sectors. We specialise in Life Assurance, Pensions, Savings and Investments, General Insurance, Commercial Insurance and Mortgages.
ProBank Austin | Education and Consulting for Financial Institutions
Our financial industry experts work to ensure that banks, credit unions, law firms, and regulatory agencies stay compliant and operate efficiently—something we have been doing for more than 50 years.
Some websites with similar theme to dupreezfs.co.za include:
Dream Destination
Dream Destination
Enzyme Technologies Home Page
Enzyme Technologies (Pty) Ltd is a biotechnology company based in Durban, South Africa.
Citrus Growers Association
Citrus Growers Association
Lloyd-Warren Construction KZN
Welcome to Lloyd-Warren Construction, where we pride ourselves on excellent service and sound construction.
My Fax2Email
MyFax2Email offers these business advantages: it uses any existing email address, it runs 24 hours a day, 7 days a week, it can receive several faxes at once, l
ProTalent
Our professional people management and development solutions assist our clients in making the most of human talent; which is still the most sustainable competitive advantage that distinguishes successful organisations from the rest.
UMONGO Petroleum
UMONGO PETROLEUM (PTY) Ltd is a large distributor in Southern Africa, with our head office based in Durban. Our core business is the supply of lubricant additiv
Hingham Nursery & Tea Garden
Hingham Nursery is a garden centre established in 1975 and has been providing efficient and friendly customer service ever since.
Home
Fairiedene Thatchers and Sundecks began erecting customized sundecks, thatch roofs and thatch gazebos in 1980 for discerning customers in Durban and surrounding areas. All timber used is S.A.B.S. approved and CCA treated to prevent termite infestation. Grass for roofing is dry and seed free. The Thatch Roof Structures are in accordance with all safety and national thatching requirements.
Home
Greystones Aviation Components (Pty) Ltd. is one of the largest fixed wing fuel systems and Rotorcraft Aircraft Maintenance Organizations registered as (AMO 141) in South Africa.
Verve Placements
Verve Placements embodies a vibrant, dynamic energy that strives towards service excellence and matching the ‘best person for the job’. Verve Placements is an independent owner managed recruitment consultancy that has been operational since 2010. We are a level 3 certified BEE compliant entity. Verve Placements is 100% owned by a Black female as per BBBEE requirements. Although Verve Placements is Durban based, we offer our recrutiment services on a national level.
Durban Floral Art Club
Durban Floral Art Club
More other alternatives for dupreezfs co za
Max Scott Engineering
Afriscan Contact Us
Where to find us
Automation Techniques
Hillcrest Advice Bureau and Bursary Fund
Glassfibre products
Home
At Inkosi Motor Holdings (Pty) Ltd we call ourselves "The King of Auto Parts" because we believe we have a great foothold within the autmotive market, and are able to meet our customer demands with great quality products and excellent service.
Durban South Panel and Paint
Durban South Panel and Paint is a progressive enterprise that continuously and consistently strives to improve the service experienced by our clients and our quest for excellence resulted in us being the first Toyota Approved body repair shop in KZN.
Permaculture 2012
Permaculture2012 – Project Management & Sustainable Development Consultants, trading as E. Gori & Associates, is managed by Ezio Gori (“Buzz”) and has a network of resources that can undertake projects in the urban regeneration / renewal, land reform, public / social housing, rural development, ecovillage / agri-village and organic farming sectors.
IRS Tronics
IRS Tronics are a service company specialising in the repairs to domestic appliances. Our experienced staff are all dedicated to delivering fast and efficient service.
Durban Website Design Studio, Custom Software, Template Website Development Company
Web House Group is Leading Durban Website Design Studio, Custom Software, Custom Template Development Company or Agency in South Africa UK, USA, Canada and Other Countries.
Home Dawson's Skipper Training
Dawson`s Skipper Training, owned and run by Paul and Wendy, developed to teach skippers to be safe at sea and inland waters through experience!
Beier Envirotec
Beier Envirotec is one of the foremost producers of technical textiles, specialised media and filtration products in Southern Africa. Beier Envirotec continues to invest in equipment and people.
Home CCP Accounting Services
CCP Accounting Services Pty Ltd is a chartered accounting firm. Our business was established to assist with the growing need for accounting and auditing services in the northern suburbs of Victoria.
Millenium Bridge
Umhlanga Ridge Town Centre
Unser Construction Cape Town
We are a professional construction company based in Cape Town, dedicated to building quality projects in a timely manner for a range of clientele.
Umfolozi Sugar Mill
Umfolozi Sugar Mill - USM is a leading producer of high quality VHP brown sugar for sale locally into the Southern African Customs Union (SACU) and internationally to various regional markets.
Kzn Project Engineering
Kzn Project Engineering
Camelot Spa, San Lameer, South Coast
The Camelot Spa at San Lameer is South Africa’s latest five star Health and Wellness Centre and the only facility of its kind on the South Coast.
