Top 100 alternative sites to ourfamilyhealth.com.au
-
wishartvillagefamilypractice.com.au
-
hawthorneclinic.com.au
-
baysidemedicalcentrebc.com
-
peakhealthnutrition.com.au
-
tophealth.net.au
-
rabymedical.com.au
-
aramohohealth.co.nz
-
nutritionsmart.com.au
-
atriofamilyclinic.sg
-
blaxlandhealth.com.au
-
advancedhealthmedical.com.au
-
headofficehealth.com.au
-
windsorroadfamilypractice.com.au
-
tichealth.co.uk
-
paradigmfamilyhealth.com
-
hamiltonmedicalcentre.com.au
-
ourfamilyhealthcenter.com
-
tyackhealth.com.au
-
paramounths.com.au
-
greenwaysmedical.co.za
-
gorehealth.co.nz
-
vibranthealthclinics.com
-
lq.org
-
tugunfamilyhealth.com.au
-
bellevueclinic.ie
-
movement101.com.au
-
southmelbournefamilypractice.com.au
-
medisilver.in
-
fhcenters.org
-
mygp.co.nz
-
nrch.com.au
-
stouffvillenhc.com
-
centerforfamilyhealth.org
-
unitedcaremedical.com
-
ecfh.org
-
bluetreeclinics.com
-
hastingshealth.co.nz
-
eastmesafamilydoctor.com
-
premier-health.ca
-
whitsundayfamilypodiatry.com.au
-
engadinemedicalpractice.com.au
-
gdmc.co.id
-
colebeemedical.com.au
-
serenityhealthcarecenter.com
-
allsaintsfamilypractice.com.au
-
elitehp.com.au
-
backtobalance.net.au
-
pendlehillfamilymedical.com.au
-
underwooddoctors.com.au
-
launchtherapy.com.au
-
qhfp.com.au
-
sapphirefmp.com.au
-
lakesidemedical.net.au
-
adjustwenatchee.com
-
midlandshealth.com
-
familiestogetheroc.org
-
cvmcutah.com
-
premierfamilymedical.com
-
leefamilyclinic.com.sg
-
greenvillemedicalcare.com
-
rototunafhc.co.nz
-
lakewoodfamilyhealth.com
-
womenclinic.ie
-
gillinghamfamilypractice.com
-
o-health.com.au
-
famhealthcare.org
-
constitutiondental.ca
-
bettercaremedicalcentre.com.au
-
blackriverhealth.org
-
kinetichealth.ca
-
amherstchiropractic.com.au
-
medicalfit.cl
-
bodyandsoulclinic.ca
-
gbariatrics.mx
-
corporevital.ro
-
mystatcare.com
-
ccrxc.ca
-
bioakor.ru
-
regenesisclinic.gr
-
jsdentalclinic.net
-
tecnisan.it
-
clinicadellago.com.uy
-
chetjohnsondrug.com
-
advancedchiroandnutrition.com
-
es.wetestu.com
-
andorracare.com
-
clinicadomo.com.br
-
springfarmmedical.com.au
-
eulalialatorre.cl
-
cardiologiaemarcapasso.com.br
-
hairdrs.com.au
-
hjy.com.mx
-
dentalzone.tv
-
lpfamilymd.com
-
tandklinik32.se
-
alliswell.net.in
-
drfan.ca
-
serclinica.net.br
-
draclaudiacenci.com.br
-
podimedic.mx
wishart village family practice
MEDICAL CENTRE OFFERING FAMILY MEDICINE, VACCINES, MEDICALS,baby checks,pathology and allied health ie: physiotherapy, psychology, podiatry dietitian
Health and Medical Care | Hawthorne Clinic | Brisbane
Hawthorne Clinic has been providing trusted medical care since the early 1920's, with our team of professionals offering a comprehensive range medical services.
Bayside Medical Centre, Specialists, Family Medicine, Walk in Clinic
Bayside Medical Centre is a new, multi-disciplinary medical clinic in Brentwood Bay, consisting of a Walk in Clinic, Specialists, GP's and allied health.
Dietitian & Nutritionist Brisbane | Peak Health Nutrition
Dietitian and Nutritionist providing expert dietary advice and programs for a wide range of health conditions and nutrition-related issues across Brisbane & Gold Coast
Belgrave Medical Clinic
Belgrave Medical Clinic in the Dandenongs specialises in family medicine across all age groups with both female and male doctors covering all health issues including disease, mental health, general practice, medication management and counselling. Caring for the community over 60 years.
Family Medical Clinic | Raby Medical Centre
Raby Medical Centre is a caring and friendly family doctors offering wide range of health care services for all ages in Raby.
Aramoho Health Centre - GP Health Services and Doctors in Whanganui
Aramoho Health Centre is a family medical clinic in Whanganui offering GP Appointments, Nurse Appointments, Health Clinics and a range of other health services for all ages.
Nutrition Smart - Brisbane Dietitians Cooking Classes Corporate Health
Brisbane Dietitians-Nutritionists and healthy cooking classes. Nutrition Smart Dietitians Matthew Lim and Kellie Gonano provide cooking classes and nutrition services for individuals and business. We provide corporate health seminars and private cooking classes. Individual consultations throughout Brisbane and online. Bulk billing for enhanced primary care plans (epc). Shop is available to purchase cooking classes and other services. Site contains food blog and cooking video.
Medical Clinic | Atrio Family Clinic | Singapore
Atrio Family Clinic is a family medicine clinic which provides a wide range of general medical services which include aesthetic procedures such as Botox, fillers and chemical peeling and also minor surgical procedures such as removal of lumps.
Blaxland Health
Welcome to Blaxland Health, a multi-disciplinary health practice, providing • Clinical consultation in psychology and social work • Individual, Family...
Advanced Health Medical Centre | Medical & Dental Practice, Bankstown
Advanced Health Medical Centre is a multi-disciplinary medical centre offering a wide range of health and dental services.
Family-focused mental health | Head Office Health | Perth
At Head Office Health our family-focused mental health and wellbeing service is for everyone. Our multi-disciplinary team offers psychiatry, hypnotheraphy, youth work and more.
Windsor Road Family Practice | Medical
Windsor Road Family Practice is a dedicated to providing the best medical services by our experience GPs.
TIC Health - The Future of Diagnostic Health - Harley Street - Home
At TIC Health, our Harley Street clinic offers a range of different medical services and deliver it to the patient under one umbrella.
Paradigm Family Health | Direct Care | Dallas
Paradigm Family Health is a Dallas direct primary care (DPC) family medicine practice, offering medical concierge services at an affordable price.
HAMILTON MEDICAL CENTRE - Bookings: 07 3268 7411
HAMILTON MEDICAL CENTRE provides friendly quality medical services to you and your family with a range of general health and wellbeing services to help improve our community.
Author: Hamilton Medical Centre
Our Family Health Center - Our Family Health Center
Our Family Health Center specializes in family services such as geriatric care, women's health, pediatric care, and adult services.
Author: – Danielle Holliday; Google Review
Tyack Health - Health & Medical Clinic Manly West, Brisbane
Tyack Health is one of the most diverse Health and Medical Clinic Brisbane has to offer. With a full range of Medical, Allied Health & Alternative Medicine services.
Your Health Is Our Priority Paramount Health Service | Paramount Health Service
Your health is important to us. Our team of experienced medical staff, nurses and GP’s at Paramount Health Service at Campbelltown, SA are committed to work around your healthcare needs.
Other sites like ourfamilyhealth com au
Family Medical Centre & Pharmacy in Port Elizabeth | Greenways
Family medical centre and pharmacy, providing quality health care, medical services, vaccinations, GP consultations and psychology to the community.
Gore Health
Gore Health Ltd is a hospital offering a range of public and private integrated services, including 16 inpatient beds, a 24/7 Emergency Department, maternity services, Gore Health Centre GP practice, dental clinic, specialist outpatient clinics, Allied and Community Health services, MoleMap, lab, radiology, and Mobile Surgical Services. Gore Health Ltd is committed to improving the health of our community by providing innovative, high quality, patient-focused healthcare. We continually str...
Medical Clinic Near Me- Vibrant Health Family Clinics
Vibrant Health Family Clinics in River Falls, Ellsworth & Spring Valley. Our medical clinics focus on providing our patients with the best clinic experience possible. We are committed to your health and well-being.
LifeQuest Family Health Care Services in Eastern PA
LifeQuest is a family of health care services dedicated to the health & wellness of people of all ages, from infants to seniors.
Author: Lqcorp
Home - Coastal Osteopathy and Family Health Clinic
Our Multi-Disciplinary Team are committed to your optimal health. Book an appointment Our Multi-Disciplinary Team are committed to your optimal health. Book an appointment Our mission, as a team of Primary Care and Allied Health Professionals, is to provide high quality, evidence-based care. Meet Our Team Our mission, as a team of Primary Care and […]
Bellevue Clinic, Mallow, Co. Cork - Multi-Disciplinary Medical Care
Bellevue Clinic is a modern multi-disciplinary clinic providing a range of services to cater patient medical needs. Our philosophy is that patient well-being is at the forefront of everything we do at Bellevue Clinic
Author: Bellevue Clinic
Movement 101 | Allied Health Clinic in Sydney
Movement 101 is a physiotherapy clinic that provides allied health services including physiotherapy, podiatry, exercise physiology, remedial massage and pilates. Call us today on 0295679452 to book an appointment at our clinics.
South Melbourne Medical Clinic | South Melbourne Family Practice
Are you looking for a medical clinic in South Melbourne? Our medical clinic is dedicated to providing you and your family a wide range of medical and support services.
Home - Your health is our seva!
Medisilver health care services Introducing our Medisilver health care services to provide standard health care with medical experts in your services.
Author: Akash P
Family Health Center :: Southern Indiana
Thanks for choosing Family Health Centers of Clark, Floyd and Harrison Counties to provide comprehensive primary and preventive health services to you and your loved ones. We are your first choice family practice of Southern Indiana.
Hong Kong Surgery | Your GP, one-stop family doctor services in Panmure.
A very affordable, high quality family doctor in Panmure. we provide a full range of medical services to multi-ethnic community and new immigrants using your native languages such as Chinese, Cantonese and English.
Home - North Richmond Community Health
Our expert male and female doctors provide bulk billed appointments in our North Richmond medical clinic. We also provide a wide range of health services including dental, counselling and casework, aged care, child health and development, alcohol and other drugs and the medically supervised injecting room. %
Naturopath, Chiropractor, Massage Therapy, Coaching | Stouffville Natural Health Clinic, Stouffville Ontario
Our goal at Stouffville Natural Health Clinic is to provide natural, practical and professional family health care solutions. We are proud to serve residents of Stouffville, Markham and surrounding areas including Uxbridge, Newmarket, Aurora and beyond.
Author: Www Stouffvillenhc Com
Home - Center for Family Health
*About COVID-19 Vaccines, and stop in at the Walk-in Clinic to get yours, today. Learn more How may we help you? Walk-In Clinic Dental Services Women’s Health Family Medicine Pediatrics School Health Pharmacy Locations The Center for Family Health is a federally qualified community health center providing primary medical care and dental services in Jackson […]
United Care Family Medical Center - Urgent Care, OB-GYN Los Angeles
United Care Family Medical Center provides quality, affordable medical care to the greater Los Angeles area. Our services include urgent care, ob-gyn and more.
Family Health Clinic Espanola | Family Care Clinic Espanola | El Centro Family Health
El Centro Family Health has a network of family health clinics offering medical and behavioral health services, dental services, and school-based health centers serving patients throughout Espanola, Springer, Roy, Embudo, Dixon, Penasco, Taos, Coyote, and the greater Southwestern United States.
Best Health Care Clinic in Dubai | Chiropractic Clinic and Specialty Services in Dubai | Blue Tree Clinics Dubai
We are a multi-specialty health care clinic providing world-class services to patients of all ages in Dubai. Visit our Blue Tree Clinics website for more.
Welcome to The Hastings Health Centre
Our team of family doctors, nurses and health professionals at the Hastings Health Centre are here to take care of your medical and health needs. We provide a full range of family doctor, nursing and special medical services along with our walk-in accident and medical service, Urgent Care. The Hastings Health Centre is CORNERSTONE Accredited Read more…
Family Doctor Near Mesa | Dr. Stacy Mickey | East Mesa Family Doctors
Looking for a family medical clinic near East Mesa? Dr. Stacy Mickey, a local family doctor, has a practice at Red Mountain Medical Plaza providing a full range of health services and treatments.
Author: I was very impressed; She is thorough; No Nonsense; I have never been so keen or confident; Office staff very helpful; Friendly
Premier-Health - Family Physician, Family Medicine
We are medical clinic with a team of dedicated & caring family physicians & staff who believe in working with our patients to maintain and improve their health.
What else ourfamilyhealth.com.au alternative websites
Best Foot Health Care Clinic? Whitsunday Family Podiatry
The Whitsundays Family Podiatry foot health care clinic help people of all ages with foot health concerns to lead a better quality of life. Book Now!
Engadine Medical Practice - Home
Engadine Medical Practice offers professional and reliable health care for you and your family. Our well trained team of experienced Doctors offer a complete range of medical services, with a friendly and caring approach to your health.
Home | Good Doctors Medical Centre
Good Doctors Medical Centre (GDMC) is a multi-disciplinary clinic located in Epicentrum Walk, Kompleks Epicentrum, Jl. H.R. Rasuna Said, Jakarta Selatan. It provides a wide range of health services.
Colebee Family Medical Centre
Colebee Family Medical Centre is a Medical Centre located inside Greenway Village. Our Female and Male doctors provide a range of services such as baby and child health, women's health and men's health.
Family Health Care Center Milwaukee | Clinical Services - Serenity Health Care
If you're looking for extraordinary health care for you and your family, look no further with Serenity Health Care. All Clinical & Family Health Care services available.We are Providence to extraordinary health system.
All Saints Family Practice
All Saints Family Practice is a family-friendly Medical Clinic providing a broad range of health services including: General Medicine, Allied Health Services and Pathology. We are 100% committed to providing you with the best health care experience. We offer bulk billing if you bring in your valid
Author: Jul
Elite Health & Performance - Chiropractors In Brisbane
FEATURING WHY USE ELITE? Elite Health and Performance is a cutting edge multi-disciplinary clinic based in Brisbane, specialising in musculoskeletal treatment and rehabilitation. Our passion is to pursue the best techniques from around the globe to create a world class
Author: Chris
Back to Balance - Family Chiropractic & Health Clinic
Back to Balance is the #1 Family Chiropractic & Health Clinic in South and Western Sydney. We have 4 clinics and a range of health services. Book Online Now
Doctor | Pendle Hill Family Medical Practice | Pendle Hill
Pendle Hill Family Medical Practice is a modern family General Practice providing holistic healthcare. We have onsite Pathology, Specialist and Allied Health services. Our healthcare and administrative staff are committed to promoting family wellbeing, disease prevention and follow up with your convenience in mind.
Family GP Clinic | Doctors @ Underwood
Doctors @ Underwood is a family GP clinic in Underwood, QLD. Our Practitioners provide comprehensive health care and general medical services. Call us for enquiries.
Family Therapy | Launch Therapy | Brisbane
Mental Health Occupational Therapy and Family Therapy for young people and families. Services provided at Rosalie Children's Centre.
Quaker Hill Family Practice | Healthy advice from your family doctor
Quakers Hill Family Practice is a purpose built multi doctor medical centre with pathology, dental and allied health services on site. Our aim to provide holistic medical care to your whole family in a kind and caring manner
Sapphire Family Medical Practice, Doctor Dasha (Daria) Fielder
Sapphire Family Medical Practice is a General Practice/Centre located in Bondi Junction. Our doctors provide state of the art, evidence based medical services.
Lakeside Medical – First Class Family Health Care
Lakeside Medical is a family medical practice committed to providing the highest quality of primary health care for our patients.
Wenatchee Spine Health Clinic | Ribellia Family Chiropractor WA
Welcome to Ribellia Family Chiropractic Established in 2006, Ribellia Family chiropractic is family oriented chiropractic clinic that welcomes people of all ages with many different types of health concerns. Learn more about the Doctor at Ribellia Family Chiropractic Meet The Doctors Download, print and fill out new patient forms
Author: Developer
Midlands Health Center
Midlands Health Center is a multi-disciplinary health clinic featuring both chiropractic and medical care to offer a comprehensive approach to your health, including care for headaches, low back pain, upper back pain, knee and shoulder pain, pregnant women, auto accident victims, and people seeking a natural approach to health.
Author: Www Georgedinsmore Com
Affordable Family Health Clinic | Families Together of Orange County
With two conveniently located low-cost health clinics in Tustin & Garden Grove, Families Together provides affordable health care services to families throughout Orange County.
Author: Tashan
Cedar Valley Medical Clinic | Family, Women's Health Care | UT
Cedar Valley Medical Clinic has been in Cedar City for 18 years and our staff has over 26 years of experience. We provide affordable family healthcare, working with patients of all ages.
Premier Family Medical | Comprehensive Health Care
Our mission at Premier Family Medical is to improve lives in the community by providing comprehensive health care and various wellness services. We offer a broad range of outpatient and inpatient services to area residents and visitors. We promote wellness and aesthetic enhancements. Learn more.
Lee Family Clinic Pte Ltd - Big or Small, We Care for All !
Lee Family Clinic Pte Ltd provides varies health care services for all ages includes different disease management programme and treatment packages. Medisave for Pneumococcal, HPV and Hep B Vaccinations are also available.
Other websites similar as ourfamilyhealth.com.au
Chiropractic Services - Greenville, NC - Greenville Medical Care
Greenville Medical Care is a family clinic that has provided the care needed for people of all ages. Call our office in Greenville, NC today!
Rototuna Family Health Centre Ltd in Rototuna, Hamilton 3210 | Rototuna Family Health Centre
Rototuna Family Health Centre LTD family medical services Hamilton. Highly skilled GP and nurse. Friendly quality service and personalised care based on your needs. clinic. general practitioner.
Lakewood Family Health - Lakewood Family Health - Home
Lakewood Family Health is a full service health and wellness clinic for people seeking personalized and personal health care. Insurance is accepted but not required. We offer convenient cash pay options. Same day appointments available, house calls availa
Women's Health&Family Planning Clinic|Dr Sahar|Kildare&Laois
At Dr. Sahar’s Women’s Health & Family Planning Clinic, we are dedicated to providing a comprehensive service for our patients.
Todd Gillingham M.D. Family Practice - Portland Family Practice Doctors ~ Gillingham Family Practice
Looking for great medical health care for yourself and your family in Portland? Here at the Gillingham Family Practice clinic our Doctors offer excellent service to their patients.
Home - O-health
After 15 years of providing services to the border region as Osteohealth, we’ve changed our name to embrace the multi-disciplinary approach we take to your health.
Family HealthCare | Fargo, ND
Family Health Care (FHC) is a family-oriented primary care clinic that provides a wide-variety of medical services for patients in the Fargo-Moorhead area.
Ottawa Dentist - Family Dentistry Downtown Ottawa, ON
At Constitution Dental, our Downtown Ottawa Dentist provides a full range of family dentistry services in Ottawa dental clinic for adults & children of all ages.
Better Care Medical Centre | Medical
Better Care Medical Centre is home to a range of high-quality primary care services, delivering the health care you need all in the one location. Our goal is to provide comprehensive quality care in a
Pender County, NC Family Health Practice - Black River Family Health Practice
We are a full-service Family Practice with three locations in Pender County, North Carolina, providing care to people of all ages.
Some websites with similar theme to ourfamilyhealth.com.au include:
Kinetic Health | Chiropractic| Massage| Acupuncture for Injury Care
Kinetic Health-Calgary, Alberta - relief from back & neck pain, headaches, & injuries. See experienced practitioners to resolve soft-tissue, musculoskeletal & sports injuries and problems using proven techniques (Motion Specific Release, Active Release, Chiropractic, Massage, and Acupuncture).
Amherst Chiropractic & Remedial Massage - Chiropractor Thornlie | Canning Vale
Our Chiropractors help to decrease pain and improve movement with cost-effective care. Our Chiropractors service Canning Vale, Thornlie, Gosnells & surrounds.
Medicalfit Chile | Prendas Compresivas Terapéuticas
Medicalfit es un equipo conformado por kinesiólogas que cuentan con una amplia experiencia en rehabilitación de cicatrices de pacientes quemados o producto de traumas, procedimientos quirúrgicos, edemas o linfoedemas principalmente.
Best Laser Skin Clinic in Toronto & Body And Soul Clinic in Vaughan
Body and Soul Clinic is the best skin & laser clinic in Toronto and Vaughan. We were VOTED #1 LASER HAIR REMOVAL clinic. Try our services today!
GBariatricS, Clínica de Obesidad | Cirujano Bariatra | Roma Sur
Clínica de Cirugía Bariátrica, Bypass gástrico, Manga gástrica, Balón intragástrico, Laparoscopia Avanzada, Endoscopia, Cirugía General, CDMX, Morelia, Querétaro, Puebla.
Cursuri de Masaj
Cursuri acreditate de ANC in urma carora se obtine « Certificat de calificare » eliberat de Ministerul Muncii Solidarității Sociale și Familiei și Ministerul Educației Naționale și « Supliment descriptiv » în care sunt menționate competențele dobândite.
StatCare Urgent Care
Same-day rapid COVID-19 testing available! No appointment needed. Access our multiple locations with a low & competitive self-pay price! Equipped to treat and manage a variety of minor emergency needs as well as other health concerns! Come see us at StatCare Urgent Care.
HOME | CCRXC - Niagara
Биоакор центр нейропсихологии и развития БАК раменское I ГЛАВНАЯ
Направление работы центра Биоакор психо-неврологическое. Центр оснащен современным аппаратно-компьютерным комплексом БАК. Психология, нейропсихология, гомеопатия, БАК.
Regenesis Clinic | Αισθητική Ιατρική, Βελονισμός, Παθολογία | Ελλάδα
Αισθητική Ιατρική, Βελονισμός, Παθολογικό Ιατρείο υπό την επίβλεψη του Ιωάννη Δ. Αλεξανδρή καθηγητή βελονισμού στο Ινστιτού βελονισμού Ελλάδος επι 22 χρόνια, κάτοχος του Master of Aesthetics and Therapeutics, UNICAM-Torino.
More other alternatives for ourfamilyhealth com au
HOME | Jsdentalclinic
Tecnisan, un mondo di salute | Ortopedia sanitaria | Trentino
Ortopedia sanitaria con oltre 20 anni di esperienza con sedi a Rovereto, Arco, Trento, Tione e Cles.
Carné de Salud | Www.clinicadellago.com.uy | Ciudad de la Costa
Clínica del Lago realizamos Carné de Salud en el día. Examen para libreta de conducir. Odontología / Promociones/ Brackets .
HOME | ChetJohnson
Chiropractor Eureka, MO | Advanced Chiropractic | Pain Relief in Eureka, MO
At Advanced Chiropractic, we treat people with low back pain, neck pain, sciatica and more! Have you been hurt in a car accident or at work? We can have with pain relief fast and effective. We offer multiple therapy techniques to help rid you of pain.
Rapid Covid Testing | WeTestU | San Diego
WeTestU offers mobile rapid covid tests for travel, Result in 15 minutes straight to your inbox. We also have a location in Mission Valley, San Diego
ANDORRA Women & Children Hospital
Indulge in the Pearl Experience at ANDORRA Women and Children Hospital! ANDORRA Fertility. ANDORRA O&G. ANDORRA Paediatrician. ANDORRA Emergency Department. ANDORRA Dermatologist.
Clinica Domo - Medicina Integrada
Clínica Domo - Medicina Integrada - Consulta Cardiológica, Check Up, Exames Cardiológicos, Convênios e Particular
Spring Farm Medical Centre
Spring Farm Medical Centre has a range of onsite services including Male and Female GPs, Podiatry, Physiotherapy, Dietitian, Onsite Pathology and Ultrasound. The Practice is open 7 days a week for your convenience.
Antienvejecimiento | Doctora Eulalia Latorre | Chile
Doctora Eulalia Latorre especialista en Medicina estética, Antienvejecimiento, Medicina Orthomolecular, ResurFX, Plataforma láser M22, Cosmiatría, Borrado de Tatuajes y Nutrición
Dr Thiago Schroder | Cardiologia e Marcapasso | Juiz de Fora
Informações sobre Arritmia e Marcapasso. Cardiologista e Arritmologista. Juiz de Fora. JF
Hair Transplant | Hair Doctors | Sydney
Hair Transplant specialists and Hair Loss clinic. We also offer PRP and hair growth medication. The most advanced hair examination, analysis and consultation. Hair Doctors.
Hospital de Jesús Yahualica | Jalisco
Hospital de Jesús Yahualica es una institución médica profesional y honesta, comprometida con la salud de la población. Que se caracteriza por su trato humano y sentido de responsabilidad.
Dental Zone | Top Dentists in Dubai | Best Dental Clinic Dubai UAE
Dental Zone Clinic is the best dental clinic in Dubai offering top quality dental treatments with the best-experienced dentists using Digital 3D Dentistry technology
Lincoln Park Family Physicians | HOME
Family Practice located in Lincoln Park serving Chicago since 1994.
Tandläkare Hässelby | Sverige | Tandklinik32
Tandklinik 32 erbjuder all form av tandvård och estetik. Just nu kampanjerbjudande 199kr. Inga väntetider, boka redan idag!
Pharmaceuticals | Alliswell Biohealth Pvt Ltd | Dehradun
Pharmaceuticals Manufacturers and Marketeers based in Dehradun. Tablets, Capsules, Syrups, Ointments, Dry Syrups, Antibiotics, Protein Powders, Injections, Drops, Eye Ear Drops, Soft Gelatin Capsules.
HOME | Mysite
Fonoaudiologia | Ser Clínica | Brasil
Especializada nas áreas de Audiologia, Fonoaudiologia, Naturologia, Psicodrama, Psicologia e Psicopedagogia, a SER CLÍNICA presta seus serviços na própria clínica, em escolas e empresas. Nosso desafio é e continuará sendo sempre o de investir em profissionais comprometidos com o atendimento especializado e humanizado.
Dra. Claudia Cenci: Clínica Dermatologia Sorocaba
A Clínica Dra. Claudia Cenci dermatologia Sorocaba é especialista em dermatologia e tratamentos de estética. Entre em contato conosco e agende um horário on-line!
Podimedic Chihuahua| Podologo | Plantillas Ortopedicas
https://www.podimedic.mx Podimedic Servicio Integral De Podologia, Atencion Especial Pie Diabetico, Uñas Encarnadas, Hongos en Uñas, Micosis Pie de Atleta Plantillas Ortopedicas Pie Plano Fascitis Plantar Sudoracion Mal Olor
