Top 100 alternative sites to performanceinstitute.org
-
governance.ca
-
itikathua.in
-
jipmer.edu.in
-
aecperformance.com
-
key-performance.eu
-
leadandgovern.com
-
questica.com
-
tiu-international.nl
-
sellabilities.com.au
-
symsoftsolutions.com
-
peii.ca
-
weareother.ca
-
gov2u.org
-
uhsrugcounselling.com
-
movementprogram.com
-
maplight.org
-
somaxsports.com
-
kpiinstitute.org
-
sherpacrm.com
-
legacyacademyfranchisereviews.net
-
erc-europeanunions.eu
-
forcescience.org
-
poafoundation.org
-
mri-international.es
-
etbs.com.au
-
aiworldgov.com
-
step-stp.com
-
governmentisgood.com
-
radcomservices.com
-
pmphealth.com.au
-
leadinggovernance.com
-
gcechd.ac.in
-
nigovernance.nl
-
itikargil.in
-
isdg.in
-
gtitraining.org
-
eldersourceinstitute.org
-
gazing.com
-
igovinstitute.org
-
phoenixmi.com
-
sterlingresearchgroup.com
-
accesscag.com
-
natureinstitute.org
-
worldmosaic.co
-
roobricks.ai
-
tinacowleyhillcrest.co.za
-
redstonegci.com
-
byrneconsult.com
-
eusg.org
-
gorrellperformancehorses.com
-
newleafperformance.ca
-
northernadvisors.com
-
iprg.in
-
performanceconsultants.com
-
accountabilityindia.in
-
ifers.org
-
performativeinquiry.ca
-
eristates.org
-
azymebio.co
-
gioets.in.statscrop.com
-
brainbodyperformance.com
-
onepersuades.com
-
krushperformance.com
-
g8performance.com
-
nanorigo.eu
-
ponemon.org
-
dietsohra.gov.in
-
simsree.org
-
vertimax.com
-
eletsonline.com
-
loepfe.ch
-
inboundfintech.com
-
netpress.de
-
hydrawell.no
-
sgi.co.za
-
kannelopisto.fi
-
kofinasfertility.com
-
info.tpro.io
-
coderacademy.edu.au
-
undb.edu.br
-
turnerandsonhomes.com
-
ecotechsrl.eu
-
liquam.com
-
ondernemerbijstalling31.nl
-
ritebite.ca
-
nodeum.io
-
clevry.com
-
higgins.com.au
-
cucollaborate.com
-
netrica.com
-
cloudswitched.com
-
r1audiovisual.com.br
-
assetline.com.au
-
adyogi.com
-
international.post.ch
-
verico.com
-
ecommerce.asendia.ch
-
gruposeguranca.com.br
-
sousecurity.com.br
-
zipx.bm
The Governance Group Consulting | British Columbia
Our mission is to improve the performance of non-profit organizations. Our approach to board governance elevates you through our proven proven processes.
Government Industrial Training Institute Kathua (ITI)
Government Industrial Training Institute Kathua (ITI) was established in the year 1981 by the Technical Education Department, Government of Jammu and Kashmir under the overall aegis of Directorate General Employment and Training (DGE&T), Ministry of labour and Employment, Government of India New Delhi.
Author: Ideogram Technology Solutions Pvt ltd
Home | Jawaharlal Institute of Postgraduate Medical Education & Research | Government of India
Jawaharlal Institute of Postgraduate Medical Education & Research, Government of India
Client Feedback, Performance Improvement, Market Research - AEC Performance
Since 1998 we have helped clients improve performance using proven data collection and analysis techniques. We provide market research, data collection and analysis as well as expert consultation on performance improvement.
Performance Monitoring | Key-Performance | Belgium
Key-Performance is specialized for more than 20 years in helping companies monitoring and improving their applications speed
AGB Institute for Leadership and Governance in Higher Education
Pathway to the Presidency The AGB Institute for Leadership and Governance in Higher Education is specifically designed for small groups of select participants aspiring to presidencies at four-year public institutions, both research universities and regional comprehensive institutions.
Budgeting, Performance, Transparency, Data Visualization & Engagement Software | Questica
Questica is a leader in multi-user budgeting, performance measures, transparency and data visualization software for governments, education & healthcare.
Improving Tilburg University – Governance – TiU-International
Personnel Fraction - Improving @ Tilburg University. Good Governance -- ♥ Education and Research -- International Mind Set -- Putting People First
Sales Consulting Firm | Sales Performance Optimisation | Sellabilities™
Training and coaching for successful sales teams. Selling doesn’t just happen. Empower your sales team to exceed their targets with our proven and trusted sales methodologies. Sellabilities™ brings 20 years of sales experience to your team. Tactical sales training to improve your organisation’s sales performance Post-training support and coaching
Author: Admin
High Performance Websites, Web Applications, And Mobile Applications For Enterprises And Government In Sacramento California - SymSoft Solut
For more than 15 years, SymSoft Solutions has delivered high-performance best-in-class enterprise web solutions to government, businesses, and educational,
Author: SymSoft Solutions
Home - Performance Excellence Institute - PEII
Performance Excellence Institute (PEI) is a project management consulting and training firm offering full services to government and corporate clients, consulting industry and contractors. The goal is to improve projects’ performance.
Other. | Canada's Preeminent Performance Marketing Agency
Other. is a performance marketing firm that helps great companies to grow faster. Industry-leading methodology, transparency & accountability.
Author: Nick Moretta
Government To You | Gov2U |
Gov2u is a NGO committed to develop citizen collaboration platforms facilitating engagement and participation to improve democracy, transparency and open-governance.
Department of Medical Education and Research, Government of Haryana
Department of Medical Education and Research, Government of Haryana
Author: Department; Research; Government
The Movement Program | Improving reading and academic performance
The Movement Program engages children in a research-based 12-week online movement program proven to improve reading, academic performance, and exam results.
MapLight – Improving Government and Democracy - Transparency Online - Software
Nonpartisan nonprofit improving government and democracy, through online transparency, voter information, and civic technology.
Somax Performance Institute
Somax is a sports performance institute that uses advanced technology to help athletes of all ages improve their performance beyond conventional coaching and improve their flexibilty beyond stretching.
Author: Bob Prichard
Worldwide Performance Excellence Solutions | The KPI Institute
Take your performance management skills at the next level with The KPI Institute education, research, publications, evaluation and certification programs.
Senior Living Sales Enablement Solution - Sherpa
Improve your senior living sales performance with Sherpa’s proven methodology, CRM software, sales training and business intelligence.
Other sites like performanceinstitute org
Legacy Academy Franchise Reviews | legacyacademyfranchisereviews.net
By employing scientifically-proven methodology, Legacy Academy franchise reviews show that this educational institution is improving the lives of children.
European Unions - ERC European Unions - Labour Politics and the EU's New Economic Governance Webseite!
5-year European Research Council project by Prof Roland Erne which aims to explore the challenges and possibilities that the new EU governance regime poses to labour politics and the methodological nationalism in the field.
Force Science Institute | Research, Training, Consulting
Promoting knowledge through research in behavioral science and human dynamics to enhance public safety, and improve officer performance in critical situations.
POA EDUCATIONAL FOUNDATION – Promote Education. Nurture Entrepreneurship. Improve Governance.
Promote Education. Nurture Entrepreneurship. Improve Governance.
We work with large companies, research institutions, government agencies and investors to improve the ROI on R&D | MRI - We work with large
We work with large companies, research institutions, government agencies and investors to improve the ROI on R&D
ETBS - Experts in Performance Assessment and IT Benchmarking
IT Service, Pricing, Performance Assessment and IT Benchmarking. Understand and improve your market position with real data and sound methodology.
Author: Scott Russell
AI World Government 2021
AI World Government provides a comprehensive two-day forum to educate federal agency leaders on proven strategies and tactics to deploy AI and cognitive technologies.
STeP - Systems that Perform
Step is a Software Development company that builds on 20 years of global experience to deliver systems that improve performance in areas of Marketing & Business Process Automation.
Government is Good - An Unapologetic Defense of a Vital Institution
Details government’s crucial role in improving Americans’ lives and promoting the public good. Also critiques the right-wing attack on government.
Author: Douglas J Amy
Human Performance Consulting - Performance Improvement for Your Business
Performance Improvement: What does that look like for your business? For more than 20 years, we have helped clients solve their most pressing problems by empowering teams to carry out their jobs more efficiently.
Author: Safety Specialist Sanitizing; Cleaning Solution Company
PMP Health - Delivering improved performance in Health Care | Sydney | NSW
PMP Health has over 20 years’ experience working with hospitals and health departments to deliver improved performance in Health Care.
Home - Leading Governance
We help improve leadership, management and performance in organisations by supporting the development of boards, board members, and governance processes.
Government College of Education Sector 20-D Chandigarh, 160020
Government College of Education Sector 20-D Chandigarh, 160020
Author: Government College
Home | Netherlands Institute of Governance
We are a Research School for Public Administration & Political Science in the Netherlands and Flanders We Teach We offer high quality PhD education on core- and cutting-edge themes in public administration and political science. More about our PhD Education We Research We offer a vibrant, ready-made research network with numerous research colloquia you can… Read More »Home
Government Industrial Training Institute Kargil
Government Institute Training Institute (Kargil), Industrial Partner NHPC
ISDG - At a Glance - Institute for Sustainable Development and Governance
Institute for Sustainable Development and Governance (ISDG) is a research and advocacy organisation involved in public policy research and documentation,Continue reading
Home - Government Training Institute
Government Training Institute - Law Enforcment Training and Military Exercises. Contact us via email: info@gtitraining.org or phone: 1-803-259-1935
Caregivers Training & Education At ElderSource Institute
Caregivers , Older Adults, and Professionals can be educated by ElderSource Institute's proven education and training program.
Gazing: Perform under Pressure. Training for leaders, managers, sales teams & coaches
Think Clearly – Feel in control – Perform. In business sport and education, Gazing trains people and teams to perform better by improving mental strength & resilience.
Author: Timc Support
Internet Governance Institute - Strengthening Grass Root Stakeholders
Internet Governance Institute (IGI) is an initiative established for strengthening Internet Governance at the grass-root level through research, capacity
What else performanceinstitute.org alternative websites
Phoenix MI
Advertising and Brand Research Firm Phoenix MI applies innovative research methodologies for advertising research, brand tracking and custom research consulting solutions to improve performance and impact your business.
Phoenix MI
Advertising and Brand Research Firm Phoenix MI applies innovative research methodologies for advertising research, brand tracking and custom research consulting solutions to improve performance and impact your business.
Phoenix MI
Advertising and Brand Research Firm Phoenix MI applies innovative research methodologies for advertising research, brand tracking and custom research consulting solutions to improve performance and impact your business.
The Nature Institute
The Nature Institute has a proven track record for incisive and thoughtful research, publications, and education programs in the field of holistic science.
World Mosaic – A global hub for entrepreneurs, educators, government, researchers and the ‘edtech’ industry
A global hub for entrepreneurs, educators, government, researchers and the ‘edtech’ industry
Automated talent and performance management
A roobrick is a smart performance coach that can cut training costs, improve transparency, and keep everyone focused on what matters most
Welcome | Tina Cowley Reading Centre Hillcrest
Tina Cowley Reading Centre Hillcrest uses a proven and tested Assisted Reading Methodology to develop learners’ potential by improving their reading skills, resulting in improved scholastic performance.
Author: Nelson Mandela
Government Consulting Services | Training for Government Contractors
Decades of Consulting, Training and Helping Government Contractors Succeed We offer a variety of services for large and small government contractors including evaluation, education and training, monitoring and DCAA audit preparation. Through our consulting and training programs, government contractors develop and learn to maintain compliance processes that help them succeed by mitigating risk and maximizing
Author: Diaadmin
TByrne & Associates | Government IT Consulting
TByrne & Associates consultants are committed and proven in providing solutions to government and higher education institutions including but not limited to ERP, Budgeting, Analytics and Cloud Computing.
Home - European School of Governance
The European School of Governance (EUSG) is a unique pan European platform for study, research and interventions. Benefit from the European way of governance and the management of complexity for better decision making and performance.
Gorrell Performance Horses | Horse Training Hanford CA
Gorrell Performance Horses and horse training for over 20 years. We specialize in horses for sale, saddles, equipment sales and horse clinics in Hanford CA.
NewLeaf Performance
Canadian. Bilingual. Professional management advisors. Strategy. Performance. Transformation. Learning. Leadership. Government. Education. Health. NGOs.
Northern Advisors Research for financial markets.
Northern provides technical research of financial markets. Northern Advisors proprietary research methodologies have been developed over the past 20 years.
IPRG – Institute for Policy Research and Governance – Institute for Policy Research and Governance or IPRG is an independent body that works
Institute for Policy Research and Governance or IPRG is an independent body that works for the purpose of social, economic and cultural upliftment of the society.
Performance Consultants, Performance Coaching Training & Consulting for Business & Individuals
Performance Consultants - The forefront of coach training, leadership development and performance improvement for individuals + organizations globally.
Home - Accountability Initiative: Responsive Governance
Accountability Initiative is a research group which works on strengthening transparency and accountability in governance. We identify and analyse the reasons that work against efficient public services delivery in India.
Institute for Education, Research, and Scholarships (IFERS)
The Institute for Education, Research, and Scholarships (IFERS) is dedicated to improving society by providing resources to high achieving students, scientific researchers, nonprofits, and educational organizations.
Home / Performative Inquiry
Performative Inquiry, Lynn Fels, Performative Writing, Arts based research, Teaching curriculum, Arts, Drama education, Education, Exploring Curriculum, Arresting Hope, Releasing Hope
ERIS | The Environmental Research Institute of the States
The Environmental Research Institute of the States (ERIS) focuses on educational and research issues to improve the environment of the United States.
Biotechnology Research Lab | Biotechnology Training Institute in Bangalore, Karnataka
Azyme Biosciences is a consortium of experienced scientists and research scholars having state of the art laboratory infrastructure with the use of newest and most innovative research methodologies.
Author: MARS WEB SOLUTIONS
Other websites similar as performanceinstitute.org
Government Institute of Electronics: Gioets.in at StatsCrop
Gioets(Government Institute of Electronics): stats, traffic, domain, Whois, IP Address, performance, security, referrals, competitors, charts and more.
Home - Human Performance Institute
Welcome! Your brain and your body have an amazing capacity to respond to you and to training. Research indicates bio and neurofeedback can improve sports and business performance, sleep, anxiety, depression, and attention/focus. Biofeedback is one of the few science and evidence-based alternatives to a pharmaceutical approach. You can create lasting changes in your brain […]
ONE | Government Relations - Research - Persuasion
ONE is a national high-stakes strategy firm. We deliver wins for companies, governments, political parties, associations, and major public and political figures. Our principals represent proven talent with backgrounds in business, government, research, associations, advertising, and technology.
Sport Performance- Long-Term Athlete & Talent Development
Athlete & Talent development programs with proven results. Research in sport performance, nutrition, mental training with Krush Performance podcasts & blogs
Author: Krush Performance
Performance Adjustable Insoles Online | G8 Performance
Leading Orthotics Insoles 🥇 Customisable Insoles 🗸 Scientifically Proven To Reduce Injuries 🗸 Improve Athletic Performance 🗸 High-Quality Products
NANORIGO – NANOtechnology RIsk Governance
NANORIGO NANOtechnology RIsk GOvernance aims to develop and implement a transparent, transdisciplinary Nanotechnology Risk Governance Framework and a related Risk Governance Council. The project is funded by the Horizon 2020 Research and Innovation Actions. The NANORIGO consortium will work closely with the two other projects funded under the NMBP-13-2018 call: RiskGONE and Gov4Nano, to ensure […]
Author: Nanorigo Admin
Home | Ponemon Institute
Ponemon is dedicated to independent research & education that advances the responsible use of information and privacy management practices within business and government.
Homepage: District Institute of Education and Training, Cherrapunjee
District Institute of Education and Training, Cherrapunjee, Government of Meghalaya
SIMSREE | Government of Maharashtra
In keeping with the rich Sydenham tradition of imparting high quality education, the Sydenham Institute of Management Studies, Research and Entrepreneurship Education (SIMSREE) was founded in the year 1983.
Athletic Performance Training Equipment | Vertimax
The most effective sports performance and athletic performance training equipment that improves speed, explosive power, agility, and vertical jump.
Author: Bruce Weber; Head Basketball Coach; Kansas State University
Elets Technomedia: ICT in Governance, Health, Education & Banking
Elets Technomedia is a technology and media research company that focuses on ICT in Governance, Education, Health and Banking & Finance.
Some websites with similar theme to performanceinstitute.org include:
B2B Inbound Marketing für Technologie-Unternehmen | HubSpot-Agentur
Storylead: B2B Inbound Marketing für Technologie-Firmen: Content Strategie, HubSpot Marketing Hub und Sales Hub, Hubspot CRM, CMS, HubSpot-Agentur Schweiz
Author: Storylead AG
Financial Services Digital Marketing Agency | Inbound FinTech
An award-winning digital growth agency, based in London, helping Financial Services businesses to drive quality leads with inbound, PPC and SEO strategies.
Author: Inbound FinTech
Inbound Marketing Agentur [1st HubSpot Elite Agency in DACH]
Als Inbound Marketing Agentur & HubSpot Diamond Partner helfen wir Ihnen, mit digitalem Marketing erfolgreich Traffic, Leads und Umsatz zu generieren.
Author: NetPress GmbH
HydraWell - Home
We have designed and developed a proprietary plugging system referred to as the Perforation, Wash & Cement (PWC®) system for wellbore applications.
Online Qualifications & Courses | Stellenbosch Graduate Institute
Online Qualifications from Stellenbosch Graduate Institute - an Education Company with Online Qualifications, Short Courses & Custom Programmes
Author: Stellenbosch Graduate Institute Pty Ltd
Kannelopisto – Etusivu
Opetustarjontaamme kuuluu ammatillisia ja tutkintoa edeltäviä koulutuksia, aikuisille suunnattuja opintoja ja laaja kurssitarjonta. Lisäksi järjestämme maahanmuuttajakoulutusta.
Author: Kanneljärven Opisto
Top Fertility Doctors New York | Kofinas Fertility Group
Best Fertility Clinic NYC: for over two decades, our compassionate, personal and skilled care has made us one of the most trusted New York fertility clinics.
Author: Kofinas Fertility Group
Medical Dictation, Speech Recognition & Transcription Software | T-Pro
T-Pro are the healthcare sector’s leading provider of medical dictation, speech recognition, transcription & clinical correspondence software.
Coder Academy | Learn to Code in Sydney, Melbourne or Brisbane
Learn to code at Coder Academy, Australia's premier technology educator offering engaging coding & STEM courses for people of all ages, abilities & backgrounds.
More other alternatives for performanceinstitute org
Estudar em São Luís - UNDB
Venha fazer parte da UNDB! Espaços inovadores, corpo docente qualificado tudo isso para capacitar melhor os nossos alunos para o mercado de trabalho.
Author: Grupo Dom Bosco
Oklahoma Custom Home Builder | Turner & Son Homes
Turner & Son Homes is a custom home builder committed to building on your land or lot. Our home building design team has years of experience building dreams
Author: Turner; Son Homes
Assistenza Informatica Aziende a Roma | Eco Tech S.r.l.
La nostra è una realtà nata dalla voglia di fornire soluzioni uniche e di valore in materia di gestione hardware e di assistenza informatica per aziende a 360°...
Author: Eco TECH S r l
Ihre externe Digitalisierungsabteilung | Liquam GmbH
Digitalisierungs-Fullservice mit starker Expertise: Liquam bietet Beratung, Umsetzung und Technologie für den digitalen Wandel aus einer Hand - Ihre Digitalberatung.
Author: Liquam GmbH
Stalling31 een nieuwe toekomst
Ritebite Orthodontics | Diamond Plus Invisalign Provider
Ritebite Orthodontics is a family-owned orthodontic practice with eight locations in Ontario. Diamond Plus Invisalign Provider.
Author: Ritebite Orthodontics
Control your Storage Data Management | Nodeum
We care about Data Management, it is about your autonomy and your agility. In 1 hour, our trial version will show how you can save 80% on costs.
Welcome to the soft side
We are the soft skills company that brings employers and employees together. Because we believe that finding the perfect match doesn’t have to be hard.
Commercial Painting Services | Higgins Coatings
Higgins Coatings is the leading commercial and industrial painting service provider in Australia.
Author: Higgins Coatings Head Office
Credit Union Consulting | CUCollaborate
Solutions that help credit unions accelerate their growth. Let the credit union consulting experts at CUCollaborate help you today.
Author: Posted by
Netrica
Where opinion meets behavior
Cloudswitched | Home Page
Centrally located in London, Shoreditch, we offer a range of IT services and solutions to small/medium sized companies, providing both on and offsite assistance.
Author: Mar
R1 Soluções Audiovisuais - Locação de Equipamentos para Eventos
A R1 é um empresa focada em soluções e planejamento para eventos corporativos. Locação de equipamentos para iluminação, som, projeção, projeção mapeada, cenografia em tecido, e muito mais.
Author: Raffaele Cecere
Assetline Capital | Home Page
Short Term Loans | Business Loans | Assetline Capital
Author: Assetline Capital
Adyogi - Ecommerce Digital Ads Automation Platform
Automate Facebook, Instagram and Google Ads for your ecommerce store and skyrocket your sales and returns upto 10x using Adyogi.
Internationalen E-Commerce Schweiz/EU optimieren - Die Post
Den Import von Waren in die Schweiz und den Export aus der Schweiz in die EU vereinfachen wir mit automatisierten Lösungen für Verzollung wie DDP.
Author: Swiss Post Ltd
Permitto | Digitalt sikkerhetskort og adgangsregistrering for elkraft
Permitto gir full kontroll på selskapets sikkerhetskort og adgangsregistrering. Brukes av anleggseier, personell, driftssentral, byggherre og leverandører.
Internationalen E-Commerce Schweiz/EU optimieren - Die Post
Den Import von Waren in die Schweiz und den Export aus der Schweiz in die EU vereinfachen wir mit automatisierten Lösungen für Verzollung wie DDP.
Author: Swiss Post Ltd
Security - Empresa de Segurança Patrimonial, Tecnologia e Facilities
Empresa especializada e referência em serviços de Segurança e Vigilância Patrimonial, Tecnologia e Facilities
Author: Security - Segurança e Serviços
Security - Empresa de Segurança Patrimonial, Tecnologia e Facilities
Empresa especializada e referência em serviços de Segurança e Vigilância Patrimonial, Tecnologia e Facilities
Author: Security - Segurança e Serviços
Home Page
ZipX Bermuda, Shop Globally, Delivered Locally. Your Address in the USA
