Top 100 alternative sites to pmccventures.com
-
taxconcepts.com.au
-
privateclientfinancial.co.za
-
nehemiahgateway.org
-
haleyconsultinggroup.com
-
visionafs.com
-
westsuburbancompanies.com
-
morecapital.com
-
russweinstein.com
-
poppletoncpa.com
-
reckonistas.ca
-
bbsofnwa.com
-
natcorp.com.au
-
grantmarketing.ie
-
firstoptionbank.com
-
ashland.ie
-
mmb.ie
-
inspirefinancial.ie
-
moneyoptions.com.au
-
munichtopia.com
-
impilion.com
-
fenergo.com
-
sciente.com
-
parkerlloydgroup.com
-
ccsonline.in
-
fundservices.hk
-
bigtim.ca
-
hadjislaw.com
-
mpa.in
-
jeromepercherancier.ch
-
panfolinvestment.ca
-
karvy.com
-
mjmaling.com.au
-
huntonak.com
-
atsfinancial.com
-
thefqgroup.com
-
upscu.org
-
g-i-f-s.ca
-
moneymanagement.com.au
-
apogeeiss.com
-
interlinkcapital.in
-
ferotek.com
-
mustaphakhoo.com
-
wnj.com
-
stacksfinance.com.au
-
vjinc.com
-
xutureit.com
-
formationfs.com.au
-
alorica.com
-
coltmans.com.au
-
capco.com
-
ofarrellfinancial.com
-
gtcfin.com
-
fintaxconsulting.ro
-
sunrajinvestments.com
-
leadone.co.in
-
aspect.co.za
-
ords.com.au
-
crgfinancialservices.com
-
firstpoint.co.uk
-
teammic.com
-
fdgroup.in
-
victoriabank.md
-
plcandassociates.com
-
cairninvestment.com
-
pallife.co.za
-
andglobal.co
-
biechele-royce.com
-
djcaccounting.com.au
-
wealthmakerfinancialservices.com.au
-
coopriderfinancial.com
-
af-equipamientos.com.ar
-
jvbusiness.net.au
-
formateur-powerpoint.com
-
formations-communication-equipes.eu
-
onthebeachvolleyball.com
-
formations-presentations-powerpoint.eu
-
calconduit.com
-
rti.co.za
-
campaignhub.com.au
-
impactindia.org
-
shopincities.com
-
vestiklt.ru
-
undertheeyeoftheclock.com
-
smartsupplies.ca
-
fall.vn
-
haccp.co.in
-
meirhosting.net
-
meirhostingdomains.com
-
bewegungsdoktor.de
-
unifrauenklinik-kiel.de
-
marekskura.pl
-
medicalsurgicalinc.com
-
zubarpraha9.cz
-
onlineflexjob.com
-
centrisinsurance.net
-
njprodrivingschool.com
-
stteresaelmira.ca
-
augenoptik-ropella.de
Tax Concepts - Home
We offer a complete range of accounting, taxation, business advisory and financial services to our clients and provide cost effective strategies and solutions.
Complete Financial Services | Private Client Financial | Cape Town
Private Client Financial is the financial services pillar of Private Client Holdings, offering expert accouting, tax, auditing and other services to individuals and businesses
Providing Economic Empowerment Programming for Over 20 Years
access to financial services and financial education, building client self-sufficiency, increasing financial well being, free individual and small business tax preparation, small business support services, virtual incubator program, financial services for small business owners, request financial services referral
Author: Delmarva Digital
Home - Haley Consulting Group LLC
Haley Consulting Group LLC is a management consultancy delivering enhanced customer experience and engagement capabilities to its clients for improved financial performance and customer loyalty.
Author: Haley Consulting Group
VISION ACCOUNTING & FINANCIAL SERVICES
Vision Accounting & Financial Services provides clients with flexible and dynamic solutions to their business needs. One-on-one, personalised client service coupled with innovative financial offerings enables us a competitive edge in the industry.
A Full Service Financial Network
West Suburban Companies is a full service financial network that provides its clients with products and services to help their business and personal lives.
More Capital | Home
A leading Lebanese Financial Institution founded in 2010 providing Asset Management and Advisory Services to corporate and affluent clients.
Weinstein Consulting
A management consultancy that creates and implements strategic business solutions for the payment, technology, financial services, and other industries.
Poppleton CPA
Poppleton CPA is a professional corporation that has been assisting clients with business and personal financial and tax services since 1981.
Reckonistas
Assisting with the financial management of entrepreneurs in the services industry so they can get back to doing whats most important, growing their business.
Bookkeeping and Business Solutions of Northwest Arkansas
Specializing in bookkeeping, accounting, payroll and related financial services for small businesses and individuals throughout Northwest Arkansas, for outsourcing your financial management needs in the Fayetteville, Springdale, Rogers area.
Natcorp Financial Services Pty Ltd
Natcorp Financial Services Pty Ltd are committed to the provision of honest, quality advice and the creation of strong relationships with clients through dedicated, ongoing service. Supported by the strength of Millennium3 Financial Services, along with key partnerships with major life offices and fund managers, Natcorp is able to provide clients with market leading solutions.
Grant Marketing & Communications - Professional Services | B2B consultants
Expert Marketing & Communications consultancy delivering effective strategies for professional services & B2B: Accountants, Law firms, Engineers, Financial Services, Technology, Healthcare, Hospitality, Tourism, business organisations
Banking and financial services | First Option Bank
First Option Bank specializes in providing the personal banking, business banking and financial services you depends on to manage your money.
Author: First Option Bank
payroll services, outsourced business services | Ashland Outsourcing
Ashland Business Process Outsourcing provides cost-effective outsourced business and financial services to companies in Ireland ranging from SME’s to large corporations, with particular industry experience in the Hotel and Hospitality sectors.
Author: Wevolution Ie Http; Www Wevolution Ie
mmb - About Us
mmb offers interim management services, providing financial management and Corporate Governance solutions to clients. The pathway to improving performance in your organisation is through appropriate structures and the provision of relevant, timely management information - mmb provides this.
Inspire Financial Options Ltd. | Financial Services | Cork
Inspire Financial Options Ltd. provides clients all over Ireland with the very best financial advice and financial services
MONEY OPTIONS - EFFECTIVE STRATEGIC FINANCIAL SOLUTIONS - ADELAIDE FINANCIAL PLANNER - Home
Money Options are an independent financial planning and wealth management company based in Adelaide. We specialise in providing personal advice in a range of financial services designed to best suit the clients personal needs and goals.
impilion - Business consulting for financial services industry, with focus on IT and project management.
International Business Consulting with the focus on IT and project management, with specific expertise in banking and financial services. Founded in april 2002 by Knut Rollig.
Author: Knut Rollig
Other sites like pmccventures com
impilion
International Business Consulting with the focus on IT and project management, with specific expertise in banking and financial services. Founded in april 2002 by Knut Rollig.
Author: Knut Rollig
Client Lifecycle Management Technology
Fenergo delivers cutting edge Client Lifecycle Management technology to help financial institutions effectively manage regulatory compliance and digitally transform how they manage and engage clients by placing them at the very heart of every business journey.
Author: Geraldine Flynn
SCIENTE - Business Technology Consulting | IT & Technology Jobs, Talent Search, Acquisition, Management Solutions | Social Innovations
Sciente is a leading specialist in Business Technology Consulting Services within financial services, banking, Insurance & telecommunications industries and IT & Technology jobs, Talent Management, Search & IT Recruitment Solutions.
Author: That is the; “ Sciente Way
Parker Lloyd Group
Parker Lloyd Group - Global Financial Experts - originally founded in 1984 as an Accountancy Practice, further client requirements led to a much broader offering of financial products: Financial Services, Wealth Management, Energy, Commodities, Technology, Hospitality and Leisure, Real Estate and Sports Marketing.
Welcome to Chennai Consultancy Services Private Ltd
We Provide Financial Advisory services in the areas of Forex and Funding, Real estate and property management,Strategic partnership building, Business advisory management consultancy,Education and Training,software projects
Hong Kong Corporate Services|Fund Services|Trust Services - FSL Fund Services Limited
FSL provides corporate clients with professional services including business administration, corporate and taxation as well as providing fund services to fund managers and their funds.
Home | bigtim.ca
Tim Deterring,Big Tim Business Services,IT Services,Financial Services
John G. Hadjis & Partners Law Firm
Our approach to the legal services we provide is both commercial and practical. By understanding our clients’ business and by anticipating their needs, our lawyers provide cost effective services at the highest quality.
Financial & Advisory Solutions | www.mpa.in
MPA Financial Services is one of the leading investment banking organization’s providing financial and advisory solutions to clients. Visit us at www.mpa.in.
Welcome to Jerome Percherancier C&R
Technology and business consulting in financial services inclusion.
Financial Advisor in Etobicoke, ON | Panfol Investment Inc +1 (416) 743-1500
Panfol Investment Inc in Etobicoke, ON specializes in financial services, wealth management, investment planning, & more. Call +1 (416) 743-1500 for a financial advisor that offers money management services today!
Karvy Financial Services Company in India
Karvy one of the top financial services companies offering customised financial solutions to its investors. Our financial services include online stock broking, wealth management, mutual funds and more.
Company - MJ Maling and Associates - COMPANY PROFILE
Welcome to MJ Maling and Associates our website Our company specialise in Taxation, Accounting and Financial Services, and our commitment to clients enables us to help business owners achieve their business and personal objectives. We provide our services within a professional culture.
Hunton Andrews Kurth LLP
Leaders in the energy, financial services, real estate, and retail sectors, we help accelerate your growth, manage your risk, and act as your advocate. Our lawyers are aligned with your business.
ATS Financial | Estate Planning | Asset Management | San Diego |
ATS is a financial services firm that specializes in multi-generational estate planning. Financial planning and asset management firm.
www.TheFQGroup.com - Corporate Advisors, Risk & Asset Management, Corporate Finance, Investment Advisors
TheFQGroup.com, Corporate Finance, Mergers Acquisitions, Business Finance, Loans, Bridging Finance, Mortgages, Commercial Mortgages, Financial Adviser, Business Advisor, Business Consultant, professional services, financial corporation, credit financial
Author: TheFQGroup com
UPS Employees CU
UPS Employees Credit Union meets its members needs by providing high quality financial services through sound financial management and friendly personal service.
Home
Griffiths Insurance and Financial Services is a company that provides insurance and investment planning for it's clients.
Australia's leading news source for investment professionals | Money Management
Money Management provides accurate and informative editorial coverage of the Australian financial services and investment management sectors.
Business Consulting Services, Business Consultants, Industry Consultants
apogee consulting in Crownsville is a boutique business consulting firm providing financial, operational and it consulting as well as strategic planning and process management services to small and mid level companies.
What else pmccventures.com alternative websites
Financial / Capital Advisor in Pune India | Interlink Capital
Interlink Capital is a Financial Advisor in Pune, provides financial services and strategies – GST, DGFT, Capital Market, Business setups & Advisory services
Ferotek Home
Ferotek is a leading global provider of Business Process Outsourcing (BPO) services. We manage customer care services and back office processes for organizations in the domain of technical support, banking, telecom, travel, retail, financial services, data and document conversion, knowledge management, transaction processing and other value additions.
Author: Ferotek Pvt Ltd
Mustapha Khoo Group of Companies
We are a one stop Financial and Corporate Service Centre offering Professional Audit & assurance,Tax planning and tax advisory, Company secretarial & corporate management, Accounting and corporate structure consultancy,Financial planning, estate planning,retirement planning, Will writing and business succession plan, Enterprise Risks Management and Internal Audit
Warner Norcross + Judd LLP | Home
At Warner we take the time to understand our clients and their business. We partner with our clients to identify issues and develop cost-effective solutions.
Home - Stacks Finance
Welcome to Stacks Finance providing financial services including funds management, commercial and consumer lending, insurance and strata management.
VJ Information & Network Consulting
VJ Information & Network Consulting (INC) is a Silicon Valley based firm providing professional services and value-based solutions across consulting, systems integration and application outsourcing. We serve the financial services, public sector and services sectors on enterprise architecture, program management, applications, product development, opportunity assessment, process redesign, change management, business scorecard, business intelligence, customer relationship management, portals, supply chain management, elearning, and web content management.
Author: VJ Information; Network Consulting INC
Xuture IT - Management consulting, technology advisory, outsourcing and IT consulting services. | Headquartered in Silicon Valley, Californi
Xuture IT is a technology consulting firm based in Silicon Valley, California. We offer professional services and value-based solutions across consulting, systems integration and application outsourcing. We serve the financial services, banking, energy, public sector and services sectors on enterprise architecture, program management, applications, product development, opportunity assessment, process redesign, change management, business scorecard, business intelligence, customer relationship management, portals, supply chain management, elearning, and web content management.
Author: Xuture IT - http; Www Xutureit Com
Home - Formation Financial Services
Founded by Michael Anderson in 2009, Formation Financial Services are Melbourne-based financial services consultants that combine exceptional service with the warmth and flexibility of a small business environment.
Alorica | A Magic Quadrant Leader in Customer Service BPO
Alorica provides a host of world-class services from customer care to financial solutions and digital services for clients across all industries.
Coltmans Legal | Financial, Corporate, Commercial Law
Coltmans Legal. A boutique legal practice for the funds management and financial services industry.
Capco - Global business and technology consultancy
Capco is a global management and technology consultancy dedicated to the financial services and energy industries.
HOME - O Farrell Financial Services
Providing financial and estate planning services to clients throughout Eastern Ontario. Working with hundreds of clients for over a decade, creating plans which make sense for them.
International Funding | Financial Services
Get the business funding you need with the help of the financial services we offer at GTC Financial Services, LTD. – Global Funding Programs in Oak Park, IL.
FINTAX Consulting - Tax Advisory | Accounting | Payroll and HR Administration services
Founded in 2004, Fintax is an independent advisory firm providing high quality consultancy services in areas such as tax, accounting, financial and management to both local and international clients, by applying local expertise within an international context.
Sunraj Investments-Insurance Advisor,Mutual fund Consultant,Financial Management Advisor
Choosing a financial advisor, financial management advisor, india financial planning consultant, india financial investment advisor, online financial advisor service in india, financial advisor company, best financial advisor, top financial advisor, financial investment advisors in india, financial planning advisor.
Author: Sunraj Investments-Insurance Advisor; Mutual fund Consultant; Financial Management Advisor
Lead One - Home Page
Corporate Services,Consultancy Services,Executive Services,Event Management,Financial Services,Secreterial Services,Legal and compliance,Aviation Services,Business Travel,Corporate Security,Ground Transportation,Corporate Meetings,Conferences,Promotional Events,Consultancy Services,Executive Security Services,corporate travel security,due diligence,secured transportation,secured Cars Vehicles,corporate risk management
Author: Lead One Services
Aspect Advisory | Finance And Risk Management Consulting
Aspect Advisory is a Financial Services Management Consulting focused in growth and strategy issues, finance and earnings optimization, and risk management.
Home - Ord Minnett | Wealth Management & Stockbroking
Ord Minnett is a leading Australian wealth management group, incorporating full-service stockbroking, financial planning and funds management.
CRG Financial Services
Financial Advisor located in Brookfield, WI. We educate and guide our clients while we manage their investments. You will know the what and the why.
First Point Insurance - Car Insurance, Home Insurance, Business Insurance & Financial Services
High Value Car & Home Insurance, Business Insurance & Financial Services
Author: First Point Insurance
Other websites similar as pmccventures.com
TEAMMIC DIGITAL CONSULTING & CAMPAIGNS
TeamMIC Advisory and Consulting. Providing excellent client service to financial services, healthcare companies and government agencies since 2003
Fourth Dimension Group - Financial & Tax Consultant | Financial Consulting Firms in Pune
Established in 2008, Fourth Dimension Group is a financial and tax consultancy in Pune that is specialised in providing end to end financial consultation services to businesses.
Victoriabank - Grupul Banca Transilvania
Victoriabank is the first commercial bank from Moldova which offers all kind of financial services to retail and corporate clients
PLC and Associates :: Marketing and Business Development Consulting
PLC And Associates is a full-service marketing and business development consulting firm that specializes in financial services.
Cairn Investment Group - Home
Cairn Investment Group is a fee only Registered Investment Advisor (RIA) based in Portland, Oregon. We provide fiduciary financial services, including financial planning, money management, and investment management.
Pallife - Home
Pallife - Pal Life is a financial services provider based in Pretoria, Accredited with F.S.C.A (Financial Sector Conduct Authority) F.S.P. Number 43259.We provide high quality financial advisory services & Insurance products. Our services are completely impartial, tailored for the needs of our clients and always in the best interests of our clients. We are not tied to single product provider which ensures that we research the entire market on behalf of our clients.
AND Global. A true fintech company.
We bring emerging technology and create new business models to offer financial services to millions of under/unbanked people in Asia, who have no or limited access to the traditional financial services.
Author: Batu Digital www batu digital
Financial Advisor | CFP | Biechele Royce Advisors | Indianapolis & Fishers
Biechele Royce Advisors is a full-service financial advisory firm that provides financial plans, wealth & investment management, based on a set fee structure.
DJC Accounting - Financial Management and Tax Advisors to Small Business
DJC Accounting focus on providing relevant financial management and tax advice to small business. We are passionate about supporting the financial needs of both the small business and its family. Contact David Chambers on 02 9588 3471.
WealthMaker Financial Services | Wealth Creation and Management
WealthMaker Financial Services (WMFS) expert mortgage brokers & financial planners who provide clients with personalised home loan, financial and retirement planning recommendations based on their individual financial goals. Call WMFS today on 02 9233 1111.
Cooprider Financial Partners - Williamsburg, VA
Cooprider Financial Partners, LLC in Williamsburg, Virginia, provides retirement planning, and financial services for individuals and businesses. We can help!
Some websites with similar theme to pmccventures.com include:
AF EQUIPAMIENTOS INDUSTRIALES S.R.L. | Soluciones confiables para la industria
JV
Business Insurance | Canberra Business Insurance Brokers - ACT Workers
Compensation Canberra, Business Insurance Canberra, Professional
I
**!! Formateur en présentations PowerPoint - Paris France
Formateur en présentations PowerPoint. Je suis consultant et formateur en communication professionnelle, et j'anime formations et coachings en présentations PowerPoint. J'interviens pour les organismes de formations continue, les entreprises et collectivités de tous secteurs et toutes tailles. En anglais et français.
**!! Formations en communication des équipes et des managers
Formations en communication des équipes et des managers. Patrick Jay forme les équipes et les managers aux techniques et bonnes pratiques de communication professionnelle. Il intervient particulièrement sur le relationnel des équipes, les aptitudes émotionnelles et la gestion des tensions et conflits.
On The Beach Volleyball
On The Beach Volleyball
**!! Formations en presentations PowerPoint - Paris, France
Formations en présentations PowerPoint. Se former pour être à la hauteur des enjeux des présentations PowerPoint. PatrickJayConsulting anime l'ensemble des formations aux présentations PowerPoint, en bilingue anglais français. Ces formations sont axées sur les techniques de présentation, complétées de techniques prise de parole en public selon la thématique. Ces services sont destinés aux entreprises et collectivités, en formation continue, en français et anglais.
Calconduit Rigid Conduit, Rigid & EMT Fittings
Calconduit – Rigid Conduit, Rigid and EMT Fittings for the electrical industry. Quality makes the difference.
RTI :: Home
More other alternatives for pmccventures com
Email Marketing | SMS Marketing | Postal Direct marketing | Fax | Sydney Melbourne
Brisbane Adelaide Perth Tasmania NT Australia
Cost Effective, High Impact eMarketing Solution. Create, Manage, Monitor Email - SMS Campaigns, Customised Newsletters, No minimum monthly committment, Start your Marketing Promotion Today - Free 1000 Credits.
Author: Beyondebiz Consulting Pty Ltd - www beyondebiz com au
Impact India Foundation
Online Shopping Canada, USA, Business and Services Directory, Shop In Cities .com
Готовые и заказные маркетинговые исследования, Бизнес-планы,
разработка биз
Готовые маркетинговые исследования, Бизнес-планы, разработка бизнес-планов, консалтинг, оценка стоимости, бизнес-планирование.
Under The Eye Of The Clock
SmartSupplies.ca
Fall.vn - Free web hosting
Fall.vn hosting - Free for the study is forever. Fall.vn Host miễn phí - Free vì sự học là mãi mãi.
HACCP Certification, Food Safety Compliance and Certification, HACCP, HACCP System, HACCP Guidelines, HACCP Benefits, HACCP Principles, HACC
HACCP (Hazard Analysis Critical Control Point) is an internationally accepted technique for preventing microbiological, chemical and physical contamination along the food supply chain. The HACCP technique does this by identifying the risks, establishing critical control points, setting critical limits, and ensuring control measures are validated, verified and monitored before implementation.
Meirhosting Limited - Domains & Hosting
Premium quality hosting. UK Personal and Business class hosting
Author: David Heath
Meirhosting Limited - Domains & Hosting
Premium quality hosting. UK Personal and Business class hosting
Author: David Heath
Bewegungsdoktor ⇒ www.bewegungsdoktor.de ⇒ Willkommen
Germany, Kiel, Hamburg, Bremen, Kinderorthopädie, Neuroorthopädie, Bewegungsdoktor, Motiondoctor, Orthopädie, Orthopedics, Dr. med. Diedrichs
Author: Hit-Enter X-Solution
Frauen- und Kinderklinik Dachau
Servicespektrum der Frauenklinik und Kinderklinik Dachau.
Dr Marek Skura - KARDIOLOG Tarnów - Specjalista chorób wewnętrznych
Marek Skura - Kardiolog, Szpital Wojewódzki im. Św. Łukasza w Tarnowie, Tarnowskie Centrum Specjalistyczne Vivamed bis - marekskura.pl
Medical Surgical Inc.763.571.5082
The Goal Post: Fixation Post & **** set
Zubní ordinace Letňany - Úvod
Onlineflexjob.com - Now Hiring Flex Workers
Cheap Car Insurance Quotes Online | Centris Insurance
Compare cheap car insurance quotes online and get the best policy for your needs. Save money with Centris Insurance quote comparison.
NJ Pro Driving School
St. Teresa Elmira-Home
Ropella - Brillen und Contactlinsen - Greifswald - Startseite
Augenoptik Ropella bietet Ihnen kompetente Beratung durch unsere in Deutschland professionell ausgebildeten Augenoptikermeister und Augenoptiker. Bei Augenoptik Ropella erwartet Sie eine große Auswahl an modischen Brillen, Sonnenbrillen und die neusten Kontaktlinsentypen.
