Top 100 alternative sites to sagprivate.co.nz
-
adviserbook.co.uk
-
wwfp.net
-
synergy.com.sg
-
rutherfordrede.co.nz
-
loudonvaughan.com.au
-
heatherduncan.ca
-
unbiased-advice.com
-
vanmeterllc.com
-
ceponisfinancialgroup.com
-
allisonsfinancial.com
-
futurefunds.com.au
-
ppf.com.au
-
northams.com
-
gpswealth.com.au
-
fsn-ltd.com
-
mobiusplanning.com
-
singcapital.com.sg
-
planstronger.com
-
financialadvisercumbria.co.uk
-
caproasia.com
-
financialassociates.co.za
-
vpbizadvisory.co.za
-
adviserinfo.sec.gov
-
chrysaliswealth.com
-
kdw.co.uk
-
addingtonfinancialgrp.com
-
acumenfs.com.au
-
infinitumfa.com
-
investmentnews.com
-
galileocapital.co.za
-
arcwealth.com.au
-
fairtreeprivateclient.co.za
-
goldleaffinancial.com.au
-
4d.co.za
-
sfsonline.com.au
-
lebc-group.com
-
primera7.com
-
financialreporter.co.uk
-
craigsip.com
-
wetalkmoney.com.au
-
wealthmakerfinancialservices.com.au
-
najjarinvest.com
-
noblefinancialgroupllc.com
-
finatoz.com
-
strictlybiz.co.nz
-
cliffeconsulting.co.nz
-
mitchellprockter.co.uk
-
sicbrokerage.com
-
simpsonfs.co.uk
-
legalinsurance.co.nz
-
youradviser.com.au
-
kahlerfinancial.com
-
leiaustralia.com.au
-
apir.com.au
-
financialadviser-info.co.uk
-
cairnfin.com
-
taxbriefs.co.uk
-
autusprivateclients.co.za
-
uljk.in
-
feastnoble.com
-
firstfd.de
-
nooralmal.com
-
businesspillars.co.nz
-
sharqinv.com
-
sharenetsecurities.co.za
-
sharenet.co.za
-
stuartcarlyon.co.nz
-
h-e-muc.de
-
financialadviceaustralia.com.au
-
laurentianbank.ca
-
en.surglap.com.mx
-
alpinistymsk.ru
-
matthiasreinigung.ch
-
aboavista.com.br
-
mbcaltadena.org
-
lessons.org.in
-
afindustrial.com.br
-
fredscranehire.co.za
-
vip-fahrschule.eu
-
sapienslabs.info
-
jazen67.wixsite.com
-
houseofcooler.se
-
institutoapta.com.br
-
restaurant-agape.ch
-
travelnurse.se
-
aoamumbai.in
-
robusthundburar.se
-
minietmoicouture.be
-
divalife.co
-
maibeauty.fi
-
aventuresh2o.ca
-
bybelstudie.co.za
-
lars390.wixsite.com
-
printyourcity.ru
-
bigsur-greylynn.co.nz
-
rijschoolgroen.nl
-
cottonandsilk.co.za
-
sp-stonepaper.ch
-
nikalapirosmani.ru
-
haugesundgulvservice.no
AdviserBook | Find a regulated financial adviser near you
Enter your postcode and find all regulated local financial advisers near you. Every adviser on AdviserBook is regulated by the Financial Conduct Authority.
Worldwide Financial Planning independent financial advisers | Worldwide Financial Planning
Worldwide Financial Planning are a whole of market independent financial adviser advising you on all aspects of financial planning, including commercial finance, mortgages, inheritance tax, investment, equity release, long term care and pensions.
Synergy Financial Advisers
Synergy is a financial advisory firm known to be proactive, progressive and reliable. We strive to be the new standard in financial guidance, creating significant value for our clients. Challenge the status quo with us.
Financial Advisers
Rutherford Rede is a national financial advisory practice supporting clients nationwide. Our origins date back to 1992. If experience is something to value, we have it in abundance.
Loudon & Vaughan - Private Wealth
Loudon & Vaughan - Private Wealth
Author: Loudon; Vaughan - Private Wealth
Heather Duncan - Certified Financial Planner / Planning, Advisor, Consultant in Ottawa, Ontario, Canada
Heather Duncan is a certified financial planner in Ottawa, Ontario, Canada, helping women plan their financial future.
WELCOME
Independent Financial Advice from Independent Financial Advisers IFA providing free consultation, advice, and information to assist you with your personal financial planning
Van Meter & Van Meter, LLC, Financial Services
Van Meter & Van Meter, LLC, your hometown financial professionals providing investments, insurance and tax-preparation services in Little Falls, New York
Author: David Van Meter
Ceponis Financial Group | Financial Management in Ridgefield, Connecticut | Serving Clients Throughout Fairfield and Westchester Counties
Ceponis Financial Group is a full-service advisory firm located in Ridgefield, CT. The firm provides a complete range of financial services which includes retirement planning, investment planning, and wealth management through a fee-based structure. Our team works with individuals as well as business owners in Fairfield and Westchester County. We continue to uphold client relations across the globe. Ceponis Financial Group is here to make sure you and your money have a mission.
Allisons Financial Planning Limited
Financial Advice from Financial Advisers providing information and advice on your personal financial planning in St.Helens
Financial advice planning | Future Funds Pty Ltd
Future Funds Pty Ltd provides lifelong financial advice to aspirational clients.
Adviser | Australia | PPF Financial
PPF Financial was established in 1975 and is a specialist provider of a range of financial services covering taxation, accounting, risk and wealth.
Home - Financial advisers, investment and pensions advice and mortgage brokers in - Honiton
Financial Advice from Financial Advisers providing information and advice on your personal financial planning in Honiton
GPS Wealth - Financial Services Licensee
GPS Wealth advisers are guiding many Australians along their financial journey through every stage, helping them to achieve success, financial freedom.
Home - Financial advisers, investment and pensions advice and mortgage brokers in - Mauritius - Financial Services Network Ltd Registered Of
Financial Advice from Financial Advisers providing information and advice on your personal financial planning in Mauritius
Vancouver Financial Planner / Financial Advisor - Mobius Planning - CFP® - Top Rated on Google
Holistic advice with a strong focus on tax efficiency. Mobius Planning founder Bily Xiao is an award-winning Vancouver financial planner / financial advisor
Author: Rudolph N - A Client Worked
SingCapital - Licensed MAS Financial Adviser
Holistic financial planning for all your life's needs. SingCapital Pte Ltd is an MAS-licensed Financial Advisory based in Singapore.
Holland Financial - Financial Adviser, Ormond Beach, Florida
Holland Financial David Holland Independent Financial Adviser in Ormond Beach
Author: Lisa Mosher
Financial Adviser Cumbria | Pension & Retirment Advice Cumbria
Richard Cakans is a financial adviser based in Cumbria. Find out how you could benefit from our financial services, including pension advice and wealth planning.
Other sites like sagprivate co nz
Caproasia.com | Leading financial & investment site in Asia | Caproasia
Caproasia.com is the leading financial website for financial professionals, professional investors & HNW investors in Asia. Covering capital markets, investments and private wealth. How do you invest $3 million to $300 million? How do you manage $20 million to $3 billion?
Author: Caproasia
Financial Advisors | Private Wealth Management
A financial services company which is well positioned to provide professional and tax efficient financial and health care guidance and comprehensive legal and accounting services.
Home
VP Business Advisory Solutions (Pty) Ltd is 100% black owned - BBBEE Level 1, Independent authorized Financial Services Provider No.51543 which provides the following Solutions: Insurance (Commercial / Business & Personal) Medical Aid, Gap Cover, Health Insurance Life / Disability / Critical Illness Cover Retirement, Pension Planning Investment Advisory Funeral Cover Legal Cover Wellness
IAPD - Investment Adviser Public Disclosure - Homepage
IAPD provides information on Investment Adviser firms regulated by the SEC and/or state securities regulators
Home - Financial advisers, investment and pensions advice and mortgage brokers in - Derby - Chrysalis Wealth Management Ltd
Financial Advice from Financial Advisers providing information and advice on your personal financial planning in Derby
KDW Financial Planning | Financial Advisers | St Albans, Hertfordshire
Our financial advisers offer independent financial planning advice across pensions, investments, mortgages, tax planning, assurance and commercial finance.
Author: KDW Financial Planning; St Albans; Hertfordshire - info co uk
Addington Financial Group
Addington Financial Group, an independent, full service, comprehensive financial planning firm, makes your life planning goals our primary concern.
Acumen Financial | Financial Planning | Mornington Peninsula
Financial Planning built on trust. Multidimensional financial services. Accessible Financial service with a personal touch
Author: Super User
Infinitum Financial Advisory
We offer reliable and customised financial solutions, covering insurance, investment, savings and retirement. Infinitum Financial Advisory is a wholly-owned subsidiary of Income and is licensed and regulated by the Monetary Authority of Singapore (MAS).
InvestmentNews - The trusted resource for financial advisers
InvestmentNews is the trusted resource for financial advisers, providing investment news and analysis for financial advisers. Extensive coverage and expert comment on important topics in the financial advisory industry.
Author: Bruce Kelly
Galileo Capital - Financial Services
Galileo Capital is a Registered Financial Services Provider (FSP), approved and regulated by the Financial Services Board (FSB).
ARC Wealth | St Leonards | Financial Advisers
At ARC Wealth we work with you to create, protect, and transfer your finances. We are financial advisers who can help you whether you're just starting on your financial journey or if you have an established portfolio already.
Fairtree Private Client | Durbanville | Cape Town | South Africa
FAIRTREE PRIVATE CLIENT (FSP 12179) is a registered and authorized Discretionary Financial Services Provider that offers integrated financial solutions.
Ethical Financial Adviser | Gold Leaf Financial | Melbourne Australia
Strategic financial advice and ethical investment. Melbourne, Australia. Helping you reach your goals and dreams and invest in line with your values.
4D - THE EXTRA DIMENSION IN FINANCIAL SERVICES
4D Tech a diverse IT company that provide software development, graphic design, IT support and more.
Strategic Financial Solutions
Strategic Financial Solutions (SFS) is an independently-owned boutique provider of financial planning services. Based in South Melbourne, Victoria, SFS has over 25 years of solid experience in delivering customised professional advice to our clients and helping them to achieve their financial objectives.
Author: Forsyte Consulting Pty Ltd
LEBC | Impartial Financial Advice | IFA | Financial Adviser | Pensions | Savings | Investments
At LEBC we create impartial financial solutions for individuals and organisations alike.
Primera 7 - Software solutions and consulting for the financial industry
Our solutions and services encompass all aspects of the financial asset management business.
Author: Primera 7
Home | Financial Reporter
Financial Reporter providers news, comment and features for mortgage and financial advice professionals in the UK
Author: Financial Reporter
Investment Advisers
We offer investment advice for private investors and corporates. We have a range of portfolio management, broking and saving solutions to meet your needs.
What else sagprivate.co.nz alternative websites
wetalkmoney - Award Winning Financial Adviser Sunshine Coast and Brisbane
Award winning financial advisor based on the Sunshine Coast helping you make complex financial decisions easily. No commissions, we only work for you.
Author: Steve; Sue Sippy Downs; QLD
WealthMaker Financial Services | Wealth Creation and Management
WealthMaker Financial Services (WMFS) expert mortgage brokers & financial planners who provide clients with personalised home loan, financial and retirement planning recommendations based on their individual financial goals. Call WMFS today on 02 9233 1111.
NAJJAR INVEST - Trading Experts - Financial Markets Forex
Learn the Secrets - Trading Experts over 18 years within Forex Trading and Financial Markets - Grow up your Funds with the most Accurate Forex Signals
Author: SHARIEF ALNAJJAR
Noble Financial Group | Advisers For Life | Lucas Noble
We provide a full array of comprehensive personal and business financial services. Feel free to contact us for a complimentary initial consultation or brief introductory conversation to determine how we might collaborate with you toward achieving your financial goals. Lucas Noble
FinAtoZ-Team of certified financial planners (CFP) SEBI Registered Investment Advisors - Bangalore
FinAtoZ is a SEBI registered investment adviser, providing professional financial planning and investment advisory services to families. Our endeavour is to ensure that our customers achieve their long-term financial goals like adequate funding for retirement, child education with proper planning and smarter investments in Mutual Funds and other best in class financial products.
Strictly Business Ltd Home Page
Strictly Business Ltd (Strictly Business) and Tony Vidler., CFP, CLU, ChFC The adviser to the advice industry. Financial services professional. Expert witness. Business Mentor providing coaching and mentoring and practical professional development for financial advisers, financial advisors, financial planner and financial planning practices. Particular skills in compliance, regulation, best practice advice, sales tools, sales training, sales skills, brand development, value creation, USP, value proposition, content marketing, digital marketing, social media marketing for professional service firms.
A client first approach to financial planning | Cliffe Consulting - Auckland
Independent financial advisers based on Auckland’s North Shore offering financial planning, investment and kiwi saver advice
Author: Cliffe Consulting
Mitchell Prockter Financial Services | Independent Financial Advisers | IFA | Investment Planning | Bedfordshire
Mitchell Prockter Financial Services Limited is one of the leading providers of independent financial services including pension schemes, investment planning for the private and corporate market place in Bedfordshire, Cambridgeshire, Buckinghamshire and Northamptonshire
Author: Mitchell Prockter Financial Services Ltd
SIC Brokerage Limited - Welcome to SIC Brokerage Limited
SIC Brokerage Limited is a Licensed Dealing Member of the Ghana Stock Exchange authorized to operate and regulated by the Securities & Exchange Commission of Ghana as a broker-dealer of the Ghanaian capital market.
Independent Financial Advice | Simpson Financial Services
Simpson Financial Services are independent financial advisers and independent mortgage brokers based in the UK. Regulated by the Financial Conduct Authority
Legal Insurance and Financial Advisers providing Insurance for Lawyers. Insurance Brokers specialists in Professional Benefits, Law Insuranc
Legal and Professional Benefits, Financial Advisers providing tailored Legal Insurance for Lawyers. Insurance Brokers specialising in Professional Benefits, Law Insurance in the Legal Profession. Call L&PB today for sound financial advice.
Your Adviser | Insurance Advisers for individuals and entities who seek protection from the financial outcome of unforseen events that effec
Your Adviser | Insurance Advisers for individuals and entities who seek protection from the financial outcome of unforseen events that effect life, assets or business.
Rapid City Financial Planning & Investment Service: Kahler Financial
Our financial planning services allow you to create and preserve the financial security to enjoy an active and independent life now and into retirement.
APIR - LEI Registration Agent
APIR Systems Limited is a privately owned utility that provides a critical component of the wealth management industry's infrastructure. We are an agent that provides multiple coding standards such as APIR, ISIN and LEI codes to the fund management industry.
Author: APIR® Systems Limited http; Www Apir Com Au
APIR - Trusted partner to the wealth management industry
APIR Systems Limited is a privately owned utility that provides a critical component of the wealth management industry's infrastructure. We are an agent that provides multiple coding standards such as APIR, ISIN and LEI codes to the fund management industry.
Author: APIR® Systems Limited http; Www Apir Com Au
financialadviser-info.co.uk - All important information about financial advisers in the UK
On financialadviser-info.co.uk you will find a complete overview of all financial advisers in the UK, with an extensive forum and relevant articles all combined in one place.
Author: Lloyd Vine Limited
Cairn Financial Advisers - Home
Providers of independent financial advice, principally to public and private companies
Content Marketing and Client Communication for Financial Advisers & Accountants
Marketing services for Financial Advisers & Planners, accountants & accountancy firms. Financial publications & financial conferences for financial advisers & financial service product providers from Taxbriefs
Certified Financial Planner | Autus Private Clients | Paarl
Autus Private Clients is a Financial Advisory and Investment Firm that assist multi-generational families, individuals and businesses in planning for financial freedom and peace of mind.
ULJK GROUP,Financial Services,Real Estate Advisory,Institutional Trading,Investment
Visit the official ULJK Website,one of India's most respected Financial Institutions which offers a range of financial services and investment products such as Institutional Trading, Real Estate Advisory, Portfolio Management, Investment Banking and Mutual Funds.
Other websites similar as sagprivate.co.nz
Feast Noble & Co LLP | Independent Financial Advisers | Herts
Feast Noble & Co is a privately owned, FSA regulated firm of Independent Financial Advisers based in London.
FIRST Financial Direct Group - A Commitment to Independence
FIRST Financial Direct Group as a qualified and licensed advisory is giving independent analysis and assessment of financial needs.
Noor Al Mal | Trade in Forex, CFDs, Energies and Metals
Noor Al Mal is a subsidiary of NCM Investment, also known as NoorCM or NCM, established in 2009 as a privately held online financial broker. Noor Al Mal is regulated by the Jordan Securities Commission under license no. 18/00403/1/3, while our parent company is regulated by the Capital Market Authority in Kuwait. (License AP/2017.0009).
Best Financial Services & Financial Advisers in Auckland
Empower your business with innovative digital solutions , We are the best Financial Advisers in Auckland , We Optimizing your performance through bookkeeping, payroll and accounting etc all type Financial Services in Auckland.
Welcome
Sharq Investment Company, regulated by the capital market Authorities (CMA), is one of the largest capital based investment companies in Kuwait. It provides Services/Investment of its funds as well as
Author: Sharq Investment
SHARENET SECURITIES
Sharenet provides financial information and services for investors on The JSE Securities Exchange and other South African markets including online share trading, real-time streaming quotes, graphs, news, fundamentals, portfolios, watch lists, Unit Trusts and simulated stock market trading.
Author: Sharenet Pty Ltd
SHARENET - Your Key To Investing on The JSE Securities Exchange - South Africa
Sharenet provides financial information and services for investors on The JSE Securities Exchange and other South African markets including online share trading, real-time streaming quotes, graphs, news, fundamentals, portfolios, watch lists, Unit Trusts and simulated stock market trading.
Author: Sharenet Pty Ltd
Stuart Carlyon | Financial Advisers Auckland
Stuart Carlyon offer clients a financial planning service that combines an unmatched experience in financial and investment planning with a broader life-goal focus.
H & E - Private Equity Partners
H & E Kapitalbeteiligungen GmbH & Co.KG - Private Equity Partners
Author: SECTOR; Www Sector
Financial Advice for Australians - Free finance tips and reporting by a Financial Adviser
Financial Advice for Australians - Free finance tips and reporting by a Financial Adviser
Laurentian Bank Financial Group
Laurentian Bank Financial Group is a diversified financial services provider whose mission is to help customers improve their financial health. We provide a broad range of advice-based solutions and services to business, retail and institutional customers.
Some websites with similar theme to sagprivate.co.nz include:
Cirugia Bariatrica | Surglap Robotic Bariatric Surgery
Surglap Robotic Surgery/ Cirugia Bariatrica asistida con robot
Промышленный альпинизм | Промышленные альпинисты Москвы | Клининговые услуги
Наша компания (промышленные альпинисты) предлагает услуги промышленных альпинистов в Москве и Московской области. Промышленный альпинизм сейчас весьма востребован. Необходимость выполнения работ на высоте растет с каждым годом. Особенно ценен труд профессиональных промышленных альпинистов, которые могут выполнить работы качественно и в сжатые срок.
Gebäudereinigung | Matthiasreinigung.ch | SchweizSchweiz
matthiasreinigung.ch die unkomplizierte und Faire Gebäudereinigung
Início | Boa Vista Plantas Ornamentais
Home | Metropolitan Baptist Church
Home | Job Skills Training Centre
Conserto De Maquinas De Marcenaria | AF INDUSTRIAL LTDA
conserto e manutenção de maquinas de marcenaria afindustrial
Mobile Crane Hire | Fred's Crane Hire Services | Gauteng
Fred's Crane Hire - the trusted name for mobile Crane Hire services in the Vaal Triangle offers 25 Ton to 130 Ton Crane Hire and Rigging Services
Vip Fahrschule Berlin GmbH in Erkner Brandenburg
VIP Fahrschule Berlin GmbH in Erkner. Wir sind Fahrschule aller Klassen
More other alternatives for sagprivate co nz
Contract Manufacturing | Sapiens Labs | Punjab
in protein bar, contract manufacturing, Sapiens Labs, Protein powder brands, manufacturing, pharmaceuticals, company profile about a manufacturing unit in Baddi associated with big brands like Healthkart, Muscleblaze and rite bite in LL and P2p bussiness model
Inicio | ESCOLA de CAPOEIRA FACA de TICUM
HEM | House of Cooler
Consultoria | Instituto Apta
Acessibilidade pedagógica e Gestão de Mediação Escolar, capacitação de professores AEE em cursos de Mediação Escolar, Consultoria Especializada de Inclusão, Palestras Corporativas e Treinamento para colaboradores PcD´s São Paulo e Rio de Janeiro. www,institutoapta.com.br
Home | agapé - cucina bistronomica a Lugano
Presentazione ristorante agapé - cucina bistronomica a Lugano con caffetteria e épicerie
Reseintyg Corona | Sjuksköterskemottagningen i Västerås AB |
Reseintyg Corona, Covid-19, Sjuksköterskemottagningen i Västerås, vaccination, PCR-test, antigentest
Home | Academy Of Architecture, Mumbai
Hundbur | Robusthundburar | Sverige
Robusthundburar tillverkar helt måttanpassade hundburar till nästan alla bilmodeller. Vi tillverkar enkelburar helburar dubbelburar baksätesburar och hundburar till skåpbilar transportbilar husbilar väktare och mobila hunddagis
Zéro Déchet Lavable Vrac Réutilisable | Mini et moi couture | Neufchâteau
créations couture, zéro déchet, liste de naissance, broderie et flocage
Esteticista | Belleza | Esthetician | Diva Life | United States
DIVA LIFE Reach Every Woman Around the World, Empower Them, Embrace Their Inside and Outside Beauty. 5 Plus Years Esthetician Expertise.
Home | Mai Beauty
Locations de Bateaux | Aventures H2O | Montréal
Le Centre Nautique du Canal de Lachine par Aventures H2O vous offre des locations de kayak et de bateaux à Montréal.
Gesinskerk Bybelstudies
Jou 1-Stop webblad vir 'n verskeidenheid Bybelstudie materiaal beskikbaar in sagteband of e-Boek formaat.
Home | LHF Radio & Service KB
Elektronik service och RF service
Технология переработки пластика | Вторая жизнь
Мы используем роботизированную 3D-печать из переработанного пластика для разработки и реализации концепций современного дизайна, имеющих высокую эстетическую ценность и социальное влияние. Экологическое движение "ВТОРАЯ ЖИЗНЬ" делает возможным создание чистого города с меньшими выбросами CO2.
Big Sur | Vegetarian & Vegan Cafe | Auckland
Nestled in the quaint West Lynn Village you'll find BIG SUR - A local cafe providing progressive and thoughtful Vegeterian & Vegan fare
Home | Rijschool Groen
Rijlessen ?gewoon doen bij Rijschool Groen
Silk Products | Cotton & Silk | South Africa
100% Pure Mulberry Silk & Egyptian Cotton Pillowcases. Cotton and Silk Facemasks with a choice of Linen or 100% pure silk lining. Facemask Chains
Start | Promotion aus Kalkstein|SP-StonePaper
Im Vergleich zu Papier auf pflanzlicher Basis ist das Steinpapier zellstoff- und faserfrei, weshalb es eine glattere Oberfläche aufweist. Dadurch absorbiert es weniger Tinte, ist allerdings genauso gut beschreib- und bemalbar. Umweltfreundliche Werbeartikel SP-StonePaper
Главная | Сеть ресторанов грузинской кухни "НИКАЛА ПИРОСМАНИ"
Parkettsliping | Haugesund Gulvservice as
Haugesund Gulvservice, Støvfri gulvsliping siden 1994, sliping av heltregulv og parkett, montering av gulvbelegg samt tepper. La oss fornye dine gulv
