Top 100 alternative sites to teammedcentres.com.au
-
primaryrobina.com.au
-
maroubramedicalanddental.com.au
-
phillipmedicalcentre.com.au
-
norwoodvillagemedicalanddental.com.au
-
ginninderramedicalcentre.com.au
-
bondijunctionmedical.com.au
-
thehillsmedicalcentre.com.au
-
craigiemedicalcentre.com.au
-
toorakmedicalcentre.com.au
-
darlinghurstmedical.com.au
-
tusmoremedical.com.au
-
sydmedicalcentre.com.au
-
greensboroughmedicalcentre.com.au
-
mainstreetmedicalanddental.com.au
-
wishartmedicalcentre.com.au
-
primarynarellan.com.au
-
hydeparkmc.com.au
-
corrimalmedicalcentre.com.au
-
wishartvillagefamilypractice.com.au
-
colonellightmedical.com.au
-
northsydneymedicalcentre.com.au
-
helensvaleplazamedical.com.au
-
karanadownshc.com.au
-
mayfieldmedicalconnection.com.au
-
activemedicalcentre.com.au
-
olivehealth.in
-
familywisemed.com.au
-
churchillroadmc.com.au
-
salemedical.com.au
-
sydneycbdmedicalcentre.com.au
-
accesshc.org.au
-
blacktownfamilymedical.com.au
-
kallangurmedicalcentre.com.au
-
rainbowhealth.com.au
-
hillmedical.com.au
-
hopemedicalcare.com.au
-
elmwoodmedical.com.au
-
caraleemedicalcentre.com.au
-
stethohealth.com.au
-
netcaremedical.com.au
-
beeliarmedical.com.au
-
rochedaledoctors.com.au
-
nwhmc.com.au
-
randwickdoctorsmedicalcentre.com.au
-
gabbamedicalcentre.com.au
-
butlerboulevardmedical.com.au
-
cooroyfamilypractice.com.au
-
bondijunction7daymedicalcentre.com.au
-
greenwayhealthcentre.com.au
-
fanniebaymedical.com.au
-
bentleighdoctors.com.au
-
coomeratownmedicalcentre.com.au
-
ssmc.com.au
-
msmedical.com.au
-
citymedicalpractice.com.au
-
surfershealth.com.au
-
rosecitymedical.com.au
-
shentonavemedical.com.au
-
medcentralknox.com.au
-
bfnstationmedicalcentre.co.za
-
kingscirclemedicalcentre.com.au
-
cannonhilldoctors.com.au
-
chapelhillfamilydoctors.com.au
-
primarymedical.com.au
-
otmc.com.au
-
northernmc.com.au
-
duffstreetclinic.com.au
-
kokstadmedicalcentre.co.za
-
fitzroynorthdoctors.com.au
-
draytonmedical.com.au
-
twomindscounsellingservices.com.au
-
adelaidemakeup.com.au
-
adelaidemetricplumbing.com.au
-
affordablewebdesignbrisbane.com.au
-
flinderscomputers.com.au
-
icschoolofmusic.com.au
-
levalexbuilders.com.au
-
stylishstitchadelaide.com.au
-
reclaimpv.com
-
malverneastfamilydental.com.au
-
affordablewebdesignadelaide.com.au
-
thorntonsrecycling.com.au
-
agedcarecourseadelaide.com.au
-
urbaninfillgroup.com.au
-
adelaideartsocietyinc.com.au
-
mobogroup.com.au
-
roadsafetyadelaide.com.au
-
oldportroofing.com.au
-
auctus.com.au
-
sgbalancedsolutions.com.au
-
titleproperty.com.au
-
ccscorrectconnections.com.au
-
australiamigrationagents.com.au
-
mercedesservicingadelaide.com.au
-
expresslocksmith.com.au
-
businesslistsa.com.au
-
profilewardrobes.com.au
-
able2drive.com.au
-
websitesadelaide.com.au
-
adelaidebeautytherapy.com.au
Primary Medical Centre Robina: Bulk Billing GPs and more
Visit Primary Medical Centre Robina. Bulk Billing GPs, Dentists, Pathology, Diagnostic Imaging, Skin Clinic, and Pharmacy. We're open 7 days a week.
Maroubra Medical & Dental Centre
The team of experienced healthcare practitioners and staff at Maroubra Medical & Dental Centre are committed to providing quality family medical care.
Phillip Medical & Dental Centre
The team of experienced healthcare practitioners and staff at Phillip Medical & Dental Centre are committed to providing quality family medical care.
Norwood Village Medical & Dental Centre
The team of experienced healthcare practitioners and staff at Norwood Village Medical & Dental Centre are committed to providing quality family medical care.
Ginninderra Medical & Dental Centre in Belconnen | Telehealth
The team of experienced healthcare practitioners and staff at Ginninderra Medical & Dental Centre are committed to providing quality family medical care.
Bondi Junction Medical & Dental Centre | Telehealth Available
The team of experienced healthcare practitioners and staff at Bondi Junction Medical & Dental Centre are committed to providing quality family medical care.
The Hills Medical & Dental Centre in Norwest & Baulkham Hills
The team of experienced healthcare practitioners and staff at The Hills Medical & Dental Centre are committed to providing quality family medical care.
Craigie Medical Centre & Dental Centre | Telehealth | Bulk Billing
Telehealth appointments are now available at Craigie Medical & Dental Centre. Click to schedule an appointment with an experienced healthcare practitioner.
Home Page - TOORAK MEDICAL CENTRE - General Medical Practice
Toorak Medical Centre
Darlinghurst Medical Centre | Telehealth Available
The team of experienced healthcare practitioners and staff at Darlinghurst Medical Centre are committed to providing quality family medical care.
Tusmore Avenue Surgery | Tusmore | Medical Centre
Welcome to Tusmore Avenue Surgery Our objective is to provide high quality comprehensive health care. Doctors, GP, General Practitioner, Medical Centre
Sydney Medical Centre
The team of experienced healthcare practitioners and staff at Sydney Medical Centre are committed to providing quality family medical care.
Greensborough Medical Centre | Telehealth | Bulk Billing
Telehealth appointments are now available at Greensborough Medical Centre. Click to schedule an appointment with an experienced healthcare practitioner.
Beenleigh Medical Centre | Bulk Billing Beenleigh Doctors
The team of healthcare practitioners and staff at Main Street Medical & Dental Centre Beenleigh are committed to providing quality family medical care.
Wishart Medical Centre | General Practice & Pharmacy Brisbane
General Practitioners at Wishart Medical Centre in Brisbane offer pharmacy, pathology and diabetes treatment. Navigate to know more about Wishart Medical Centre.
Narellan Medical Centre | Telehealth | Bulk Billing Narellan Doctors
Telehealth appointments are now available at Narellan Medical Centre. Click to schedule an appointment with an experienced healthcare practitioner.
Family Doctor - Hyde Park Medical Centre
Hyde Park Medical Centre - Open 7 days family doctor,Bulk Billing,Travel Clinic Corporate Flu Vaccine,Skin Cancer Clinic, Sydney CBD doctor
Corrimal Medical Centre | Telehealth | Bulk Billing Corrimal Doctors
Telehealth appointments are now available at Primary Medical Centre Corrimal. Click to schedule an appointment with an experienced healthcare practitioner.
wishart village family practice
MEDICAL CENTRE OFFERING FAMILY MEDICINE, VACCINES, MEDICALS,baby checks,pathology and allied health ie: physiotherapy, psychology, podiatry dietitian
Other sites like teammedcentres com au
Colonel Light Medical Centre - Home
Family Medical Clinic in Adelaide with Doctors, GPs, Physiotherapist, psychologist and audiologist
General Practitioner | North Sydney Medical Centre
North Sydney Medical Centre offers General Practice medicine in North Sydney. We are offer bulk billing for standard and general practice services.
HELENSVALE PLAZA MEDICAL CENTRE - BULK BILLING
Helensvale Plaza Medical Centre introduces a significant advancement in the delivery of primary health care. It is a state-of-the-art healthcare facility with experienced doctors and friendly staff. We are a fully bulk billing medical centre open 7 days per week.
Karana Downs Health Centre
Karana Downs Health Centre has integrated medical doctors, psychologists, dietitians and lifestyle counsellors into a health and wellbeing team.
Medical Centre GP Newcastle | Book Online | Mayfield Medical Connection
Medical Centre and Newcastle Doctors GP offering Pathology, Psychology, Naturopathy and Accupuncture. Affordable family doctor, non-bulk billing. Book online.
Active Medical: Caroline Springs Medical Centre
Active Medical is a modern Caroline Springs medical centre staffed by a caring and experienced team of doctors. Xray and pathology onsite. Bulk billing.
Pune's Medical Centre | Olive Health Centre | Pune
Diagnostics, pathology, gynaecologists, psychologist, dietician and lots of other medical professionals are at your service. Book your appointment at Olive Health Centre now!
Bulk billing | GP Castle Hill | FamilyWise Medical Practice | Telehealth
Familywise bulk billed Medical Centre which offers GP Doctors, dietician, psychologist and physio in Castle Hill. General Practice & Preventitive care.
Churchill Road Medical Centre – Family Health Care
Churchill Road Medical Centre is a bulk billing general practice with a number of male and female doctors available. It is just 6kms from the Adelaide CBD on the corner of Alexandra Street and Churchill Road in Prospect, providing convenient access to patients in Prospect, Kilburn, Blair Athol, Enfield, Nailsworth and Brompton. There is a bus stop at the front door (BUS STOP 12) and ample off street car parking.
Medical Practice | Sale Medical Centre | Sale
If you're look for a bulk billing sale medical centre, we’re here for you when you need us! Sale Medical Centre is a Medical Practice with local doctors.
Bulk Billing Doctors Sydney | Sydney CBD Medical Centre
Sydney CBD Medical Centre's friendly & experienced team offer complete GP medical services. Short waiting times. Bulk Billing available. Book a visit today.
Bulk Billing Medical Centre, GP Near You, Local Female Doctors Melbourne
AccessHC has bulk billing doctors offering a range of medical & allied services in Melbourne. Our medical centre has professional general practitioners near you who will address whatever needs you may have.
General Practice | Blacktown Family Medical Centre
Blacktown Family Medical Centre providing you with health services including General Practitioners / Doctors, Specialist, Allied health Practitioners, Pathology and Radiology onsite. Bullk billing with Medicare Card and we are open 7 days.
Kallangur Medical Centre | Bulk Billing Doctors in Kallangur
Kallangur Medical Centre in Kallangur Brisbane is a Bulk Billing Medical Centre. Our experienced doctors offer a comprehensive general health service. We offer Care, Compassion and Confidence to all patients.
Rainbow Health | Rainbow Health Medical Centre
Rainbow Health Medical Centre that are Bulk billing payment option under the Medicare system, It can cover a prescribed range of health services.
Hill Medical Services Home
Hill Medical Services- Excellence in Healthcare.Most healthcare services provided on-site including doctors, chiropractor, exercise physiologist, psychologist, physiotherapist, podiatrist, dietitian, diabetes educator, all childhood checks and vaccinations, travel vaccinations (including yellow fever), family therapist, chronic disease management
Hope Medical Care - Medical Centre, Bulk Billing
Bulk Billing Medical Centre, Same Day Appointments, Open 7 Days A Week, Female and Male Doctors, New Patients Welcome, pathology, chemist, imaging, Ph 4367 5888
Author: Hope Medical Care
Wodonga Medical Centre & Bulk Billing Doctors Wodonga | Elmwood Medical
Elmwood Medical is your Wodonga Medical Centre. Our doctors in Wodonga are caring, friendly, highly experienced and fully bulk billing. We are your one-stop bulk billing medical centre in Wodonga.
Caralee Medical Centre | Willagee GP | Bulk Bill Medical Centre
Best Medical Centre in Willagee, Perth, WA. Caralee Medical Centre is a bulk bill GP Clinic with Australian trained doctors.
Stetho Health Cranbourne - Medical + Dental Centre
Visit our Bulk Billing Medical Centre or book your Tele Consult today. We have male & female GPs, and offer general family medical as well as specialist services.
What else teammedcentres.com.au alternative websites
Bulk Billing Doctors Melbourne at Moonee Ponds Medical Centre
A leading Moonee Ponds medical centre serving the public by bulk billing doctors Melbourne. Consisting of a skin cancer clinic and bulk billing medical centre.
Author: Super User
Beeliar Medical Centre | Beeliar GP | Beeliar Medical Group
Beeliar Medical Centre is one of the best Medical Centre with fully bulk billing practice and is owned and managed by doctors who work in the practice.
Rochedale Doctors - Bulk Billing Medical Centre, Rochedale
Need a bulk bill doctor? Rochedale Doctors offers a comprehensive range of general medical services to the local community and surrounds
Northwest Health Medical Centre
Northwest Health Medical Centre is committed to provide comprehensive medical care to everyone in Northwest Sydney and the surrounding areas. Situated in the heart of the beautiful Northwest corridor, with the new Metro system and the expanding young vibrant population, we are open for long hours and have a holistic approach to patient care.We are currently staffed by 3 full time and 2 part time doctors. There are female doctors available for consultation by appointment.
Randwick Doctors Medical Centre - Family Medical Practice
Randwick Doctors Medical Centre is a family medical practice with GP Doctors & allied health, Open 7 days (Saturday & Sunday), Bulk Billing available.
Author: Quality; Innovative; Accessible Healthcare
Bulk Billing Doctors In Woolloongabba & Health Care Medical Centre
The Woolloongabba Doctors is a team of Bulk Billing doctors, provides a high standard medical care and health management at Woolloongabba Medical Centre.
Butler Boulevard Medical Centre | Multidisciplinary Clinic Perth
Butler Boulevard Medical Centre welcomes all patients to our clinic in Perth. We are General & more Practitioners, Physios, women’s and men’s specialists
Family Medical Centre & Doctors Cooroy, Eumundi & Nearby Suburbs - Cooroy Family Practice
Cooroy Family Practice is a community focused medical centre in Cooroy providing a complete family health services from Cooroy, Eumundi & Gympie and surrounding suburbs with 100% BULK BILLING. Call 07 5472 0064
Bondi Junction 7 Day Medical Centre - 100% BULK BILLING
Bondi Junction Medical Centre GP Doctors. Pharmacy/Chemist/Pathology. FULLY BULK BILLED. Yellow Fever/Travel Vaccinations. No Appoint. Ph: 9291 9888.
Greenway Health Centre
Greenway Medical Hub in Wetherill Park operates 7 days a week and offers essential health services including bulk billing GPs, pathology, radiology, pharmacy, allied health and specialists, as well as a full dental clinic.
Fannie Bay Medical Centre | Local Doctors | Bulk Billing Doctors in Darwin
Fannie Bay Medical Centre is a modern and new bulk billing medical centre in Fannie Bay that offers patients high quality comprehensive health care. With male and female doctors and onsite pathology, the centre is open 7 days a week and has on site parking for patient convenience.
Family Medical Centre | 100% Bulk Billing | Bentleigh Doctors
Our medical centre - Bentleigh Doctors - offers bulk billing to all patients while providing the highest level of medical care and offering a broad range of medical services to everybody.
Doctors at Coomera Town Medical Centre
Coomera Town Medical Centre are Bulk Billed doctors at Coomera who also offer after hours service located at Coomera Town Centre. Open 7 Days a week.
Sydney Sports Medicine Centre - Sydney Olympic Park, Homebush
Sydney Sports Medicine Centre is one of the largest multi-disciplinary Sports Medicine practices in Australia. Located in the NSW Institute of Sport building, we encompass all aspects of Sports Medicine including Sports Physicians, Sports Physiotherapists, Podiatrists, Orthopaedic Consultants, Massage Therapists, Dieticians, Exercise Physiologists and Sports Psychologists. Most of our practitioners are involved with professional or National Sporting, Commonwealth and Olympic Games Teams.
Main Street Medical, Lilydale, Melbourne VIC Australia
Our general practitioners in Melbourne, Lilydale offers quality consultation, medical services by expert doctors, We are also a leading bulk-billing clinic.
City Medical Practice - Bulk Billing Doctors / GP - Sydney CBD
City Medical Practice is a bulk billing general practice located in Sydney CBD. Our doctors welcome new patients and walk-in appointments.
Welcome | Surfers Health Medical Centre
Medical Centre in Surfers Paradise, Gold Coast. Bulk Billing Female and Male Doctors, Open 6 Days
Rose City Medical Centre, Rose City Shopping World, Warwick
Warwick new bulk billing doctors & medical centre open on January 15th.
Shenton Avenue Medical Centre provide After Hours Doctors in Currambine, Connolly, Ocean Reef, Kinross, Iluka, Burns Beach & Joondalup areas
With after-hours appointments and bulk-billing services, Shenton Avenue Medical Centre welcomes all patients. Make an appointment today
Bulk Billing Medical Centre Near Me | Medical Clinic Knox
Bulk Billing Medical Centre Near Me. Experienced health professionals. Friendly doctors conveniently located in Westfield Knox Shopping Centre
Other websites similar as teammedcentres.com.au
Bloemfontein Station Medical Centre | Private clinic in Bfn
We have the best Medical Doctors at Bloemfontein Station Medical Centre. Our Services:Optometries, Dental, Physiotherapist, Psychologist, Dialysis, Social Worker, Professional Nurse, Clinical......
Kings Circle Medical Centre, Caboolture - Bulk Billing Doctors
Need a doctor in Caboolture? Kings Circle Medical Centre offers bulk billed medical services from its clean, modern facilities on Kings Street, near the Amcal Pharmacy.
Bulk Billing Doctors In Cannon Hill & Health Care Medical Centre
The Cannon Hill Doctors is a team of Bulk Billing doctors, provides a high standard medical care and health management at Cannon Hill Medical Centre.
Bulk Billing Doctors In Chapel Hill & Health Care Medical Centre
The Chapel Hill Doctors is a team of Bulk Billing doctors, provides a high standard medical care and health management at Chapel Hill Medical Centre.
Medical Centre Hervey Bay | Primary Care Medical Clinic | Urraween
Consult Your Doctor at Primary Care Medical Clinic in Urraween. Leading Medical Centre Hervey Bay. We Bulk Bill All Medicare Rebatable Consults.
Doctors Sydney CBD Kent St. Observatory Tower Medical CentreObservatory Tower Medical Centre
Observatory Tower Medical Centre, the most convenient medical centre in Sydney’s CBD. We offer a full range of services. Professional Doctors.
Northern Medical Centre | Salisbury & Salisbury East Bulk Billing Doctors
At Northern Medical Centre our bulk billing GP doctors are caring and highly experienced. Northern Medical Centre caters for patients in Salisbury, Salisbury East & Brahma Lodge. We are your own stop bulk billing medical centre in Adelaide.
Duff St Medical Clinic | Cranbourne Medical Centre (Bulk Billing)
Duff St Medical clinic is a one stop Bulk Billing medical centre Cranbourne West. All Medical services and Wellness Centre. 15 doctors on site. OPEN 7 DAYS
Kokstad Medical Centre - Home
Kokstad Medical Centre - Offering comprehensive medical care by skilled general practitioners
Family Medical Centre - Bulk Billing | Fitzroy North Doctors
Our medical centre - Fitzroy North Doctors - fully bulk bills all patients while providing the highest level of medical care and offering a broad range of medical services to everybody.
Family Friendly Skin Doctors & Medical Centres In Toowoomba
At Drayton Medical Centre in Toowoomba, our family skin doctors are experienced in treating patients of all ages. Welcoming new patients and offer bulk billing.
Author: Dhahan
Some websites with similar theme to teammedcentres.com.au include:
Two Minds Counselling Services | Adelaide
Two Minds Counselling provides services in anxiety and stress Management, counselling for disabled child, grief and bereavement counselling, mental therapy
Author: Two Minds Counselling Services
Adelaide Makeup Artist Natasha Martin
Adelaide Makeup Artist Natasha Martin - the professional choice for makeup artists in Adelaide, specialising in bridal & special occasion makeup, hair and beauty.
Plumbing services in Adelaide | Gas services
General plumbing services in Adelaide. Commercial plumbing, hot water and gas services. Our Plumbers and Gas Fitters are Licensed and Qualified.
Author: Metric Plumbing; Gas Solutions Adelaide
AFFORDABLE WEBSITE DESIGN | BRISBANE | AUSTRALIA
Quality affordable website design in Brisbane, Australia. As a website design agency, we have been servicing businesses throughout Australia for many years.
Author: ITN LAB
Sunshine Coast Computer Services and Networking
A wide range of computer services for businesses and individuals across Sunshine Coast area. Computer diagnostics and repair, data recovery and backup.
Author: Flinders Computer Systems
Irina Cherkasski School of Music
Irina Cherkasski School of Music - the leading provider of professional music education in Melbourne.
Author: Irina Cherkasski
Home Building and Renovation Modbury, Adelaide
Home building, renovations and extensions Adelaide, Modbury. Decking, verandah, carports and pergolas installation. Personalised design and build services.
Author: Levalex Builders
Stylish Stitch Adelaide
Adelaide's leading Alterations and Tailoring specialist. I am highly regarded for my superior craftsmanship and award-winning customer service.
Author: Stylish Stitch
Reclaim PV Recycling - solar panels recycling Australia
Reclaim PV Recycling is an Australian based Photovoltaic (PV) recycling service.
Author: Reclaim PV Recycling
More other alternatives for teammedcentres com au
Dentist Malvern | Malvern East Family Dental
Malvern East Family Dental in Melbourne offers a full range of services to look after your **** health, from general dentistry to appearance dentistry.
Affordable WEB DESIGN in Adelaide | Easy to update website
We build stylish, professional, SEO friendly websites and web applications that are affordable while effectively delivering results to our clients in Adelaide.
Author: ITN LAB
Bottle Recycling Adelaide | Bottle Recycling Depot Adelaide
Bottle Recycling Adelaide - Thortons recycling recycles bottles, cans, plastic and cardboard. Quick and easy recycling in Adelaide.
Aged Care Course Adelaide | Government Funding Available
Aged Care Course Adelaide, SA - Auctus offers our students the opportunity to get a qualification in Aged Care, SA. We don’t just provide you with a certificate, but we give you the confidence to put your new learnt skills in place.
Author: Auctus Aged Care Course
Urban Infill Group Adelaide
Residential property development, Site acquisition, Project management, Joint venture and partnerships, Finance broking, Training and education.
Author: Urban Infill Group
Adelaide Art Society of South Australia
Adelaide Art Society
Author: Adelaide Art Society
Disability Employment Services in Adelaide, SA | Mobo Group
Mobo Group is NDIS Provider existing to enable Disability Employment Services and Disability Enterprises in Adelaide and South Australia.
Author: Mobo Group
Road safety products supply and installation
Road Safety Adelaide provides high-quality road safety products: anti-slip flooring, tactile indicators, stair nosing, safety bollards and more.
Author: Road Safety Adelaide
Roofing Adelaide | Roof Replacement | Roof Repairs | Old Port Roofing
Roofing Adelaide. Old Port Roofing has the capability of managing any sized project from small to large.
Author: Old Port Roofing Adelaide
Certificate IV in Training and Assessment I Auctus, Adelaide
Certificate IV in Training and Assessment, Aged Care and Disability courses in Adelaide. Government funding available. Nationally accredited. Classroom delivery.
Bookkeeper Adelaide | Xero Book Keeping | SG Balanced Solutions
Bookkeeper Adelaide - SG Balanced Solutions offers Book keeping services throughout Adelaide. We are Xero specialists and offer remote bookkeeping to a range of clients.
Author: Bookkeeping Adelaide
Adelaide Real Estate at Title Property
Your Personal Real Estate Experts. Find your ideal property on titleproperty.com.au
Author: Title Property
Home theatre installation Adelaide | Digital antenna installation Adelaide
Bringing your system to life!
Author: CC'S Correct Connections
Migration Centre Adelaide - South Australia | Immigration services
Migration Centre Adelaide - South Australia | Immigration services. Our services include skilled, employer sponsored, family, student and visitor visas. Call us today for all your migration requirements.
Author: Migration Centre
Mercedes Servicing Adelaide | Mercedes Benz Service and Repair
Mercedes Servicing Adelaide - Logbook Servicing and Repairs Adelaide- Mainstyle Motors offer a quality service and repair centre - call today to find out more or to book.
Author: MAINSTYLE MOTORS
Locksmith Adelaide | Mobile Locksmith Adelaide | Keys Cut
Locksmith Adelaide | Mobile Locksmith Service | Express Locksmith offers a 24/7 service specialising in all your Home, Commercial and Car requirements. Lockouts and Keys Cut. Call today for an express service.
Author: Express Locksmith Adelaide
Business List SA | FREE BUSINESS LISTING - Adelaide
Business List SA is an online business directory created mainly for small and home-based businesses in Adelaide. Free listing with full details and description.
Author: Affordable Web Studio
Built In Wardrobes Adelaide | Profile Wardrobes
Profile Wardrobes in Adelaide is one of South Australia's premier built in wardrobe companies, installing quality storage solutions in Adelaide homes since 1992. Our friendly knowledgeable team will work with you to provide design ideas and options to ensure your built-in is designed exactly to your needs.
Author: Profile Wardrobes Adelaide
Able2Drive Adelaide driving school Oakden, Adelaide
Adelaide driving school, Oakden. Able2Drive driving lessons specifically designed to assist students to pass the driving test and provide practical driving skills.
WEBSITE DESIGN | ADELAIDE | AUSTRALIA
We are an experienced team of website designers in Adelaide with around 20 years of experience creating websites and web applications.
Author: ITN LAB
Alla Falko and Her Beauty Salon in Adelaide
We are offering the latest skin care and unique beauty treatments: **** massage, Enzyme therapy, Peelings, Pigmentation Removal.
